Products

Primary Antibodies (2)
View as table Download

Rabbit Polyclonal TTYH1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TTYH1 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human TTYH1.

Rabbit Polyclonal Anti-TTYH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TTYH1 Antibody: synthetic peptide directed towards the N terminal of human TTYH1. Synthetic peptide located within the following region: GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA