Products

cDNA Clones (7)
Proteins (5)
Antibodies (1)
Jump to Filters
View as table Download
CACNG3 (NM_006539) Human Tagged ORF Clone
RC207373

USD 420.00

In Stock

CACNG3 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 3 (CACNG3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CACNG3 (NM_006539) Human Tagged ORF Clone
RC207373L3

USD 620.00

3 Weeks

Lenti-ORF clone of CACNG3 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 3 (CACNG3)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG3 (NM_006539) Human Tagged ORF Clone Lentiviral Particle
RC207373L3V

USD 820.00

6 Weeks

Lenti ORF particles, CACNG3 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 3 (CACNG3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG3 (NM_006539) Human Tagged ORF Clone
RC207373L4

USD 620.00

3 Weeks

Lenti-ORF clone of CACNG3 (mGFP-tagged)-Human calcium channel, voltage-dependent, gamma subunit 3 (CACNG3)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG3 (NM_006539) Human Tagged ORF Clone Lentiviral Particle
RC207373L4V

USD 820.00

6 Weeks

Lenti ORF particles, CACNG3 (mGFP-tagged)-Human calcium channel, voltage-dependent, gamma subunit 3 (CACNG3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG3 (NM_006539) Human Tagged ORF Clone
RG207373

USD 460.00

3 Weeks

CACNG3 (GFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 3 (CACNG3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNG3 (NM_006539) Human Untagged Clone
SC116025

USD 310.00

In Stock

CACNG3 (untagged)-Human calcium channel, voltage-dependent, gamma subunit 3 (CACNG3)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CACNG3 Rabbit Polyclonal Antibody
TA338562

USD 375.00

5 Days

Rabbit Polyclonal Anti-Cacng3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cacng3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRARS
CACNG3 (NM_006539) Human Over-expression Lysate
LC416581

USD 121.00

2 Weeks

CACNG3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNG3 (NM_006539) Human Over-expression Lysate
LY416581

USD 396.00

5 Days

Transient overexpression lysate of calcium channel, voltage-dependent, gamma subunit 3 (CACNG3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNG3 (NM_006539) ICC Control Block
TB407373

USD 1,070.00

4 Weeks

Transient overexpression of CACNG3 (NM_006539) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CACNG3 Cytosection
TS407373

USD 225.00

4 Weeks

Transient overexpression of CACNG3 (NM_006539) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CACNG3 Cytosection
TS407373P5

USD 889.00

4 Weeks

Transient overexpression of CACNG3 (NM_006539) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack