Germany
Japan
United Kingdom
China
KCNAB3 (Myc-DDK-tagged)-Human potassium voltage-gated channel, shaker-related subfamily, beta member 3 (KCNAB3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, KCNAB3 (Myc-DDK tagged) - Human potassium voltage-gated channel, shaker-related subfamily, beta member 3 (KCNAB3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, KCNAB3 (mGFP-tagged) - Human potassium voltage-gated channel, shaker-related subfamily, beta member 3 (KCNAB3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, shaker-related subfamily, beta member 3 (KCNAB3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNAB3 (Myc-DDK tagged) - Human potassium voltage-gated channel, shaker-related subfamily, beta member 3 (KCNAB3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, shaker-related subfamily, beta member 3 (KCNAB3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNAB3 (mGFP-tagged) - Human potassium voltage-gated channel, shaker-related subfamily, beta member 3 (KCNAB3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
KCNAB3 (GFP-tagged) - Human potassium voltage-gated channel, shaker-related subfamily, beta member 3 (KCNAB3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human potassium voltage-gated channel, shaker-related subfamily, beta member 3 (KCNAB3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human potassium voltage-gated channel, shaker-related subfamily, beta member 3 (KCNAB3), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-KCNAB3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNAB3 antibody: synthetic peptide directed towards the N terminal of human KCNAB3. Synthetic peptide located within the following region: RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEV |
KCNAB3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of potassium voltage-gated channel, shaker-related subfamily, beta member 3 (KCNAB3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
KCNAB3 MS Standard C13 and N15-labeled recombinant protein (NP_004723)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
KCNAB3 (untagged)-Human potassium voltage-gated channel, shaker-related subfamily, beta member 3 (KCNAB3)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SC310435 is the updated version of SC122181.
Transient overexpression of KCNAB3 (NM_004732) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of KCNAB3 (NM_004732) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of KCNAB3 (NM_004732) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- KCNAB3
Families
- Ion Channels: Other