SHKBP1 (Myc-DDK-tagged)-Human SH3KBP1 binding protein 1 (SHKBP1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SHKBP1 (Myc-DDK-tagged)-Human SH3KBP1 binding protein 1 (SHKBP1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human SH3KBP1 binding protein 1 (SHKBP1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, SHKBP1 (Myc-DDK tagged) - Human SH3KBP1 binding protein 1 (SHKBP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, SHKBP1 (mGFP-tagged) - Human SH3KBP1 binding protein 1 (SHKBP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
SHKBP1 (GFP-tagged) - Human SH3KBP1 binding protein 1 (SHKBP1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human SH3KBP1 binding protein 1 (SHKBP1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SHKBP1 (Myc-DDK tagged) - Human SH3KBP1 binding protein 1 (SHKBP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human SH3KBP1 binding protein 1 (SHKBP1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SHKBP1 (mGFP-tagged) - Human SH3KBP1 binding protein 1 (SHKBP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human SH3KBP1 binding protein 1 (SHKBP1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human SH3KBP1 binding protein 1 (SHKBP1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
SHKBP1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
SHKBP1 (untagged)-Human SH3KBP1 binding protein 1 (SHKBP1)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal antibody to SHKBP1 (SH3KBP1 binding protein 1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 162 and 477 of SHKBP1 (Uniprot ID#Q8TBC3) |
Transient overexpression lysate of SH3KBP1 binding protein 1 (SHKBP1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-SHKBP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SHKBP1 antibody is: synthetic peptide directed towards the N-terminal region of Human SHKBP1. Synthetic peptide located within the following region: TVFAPILNFLRTKELDPRGVHGSSLLHEAQFYGLTPLVRRLQLREELDRS |
SHKBP1 MS Standard C13 and N15-labeled recombinant protein (NP_612401)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
SHKBP1 (untagged)-Human SH3KBP1 binding protein 1 (SHKBP1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression of SHKBP1 (NM_138392) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SHKBP1 (NM_138392) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SHKBP1 (NM_138392) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack