Products

View as table Download

SHKBP1 (Myc-DDK-tagged)-Human SH3KBP1 binding protein 1 (SHKBP1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, SHKBP1 (mGFP-tagged) - Human SH3KBP1 binding protein 1 (SHKBP1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

SHKBP1 (GFP-tagged) - Human SH3KBP1 binding protein 1 (SHKBP1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human SH3KBP1 binding protein 1 (SHKBP1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human SH3KBP1 binding protein 1 (SHKBP1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SHKBP1 (mGFP-tagged) - Human SH3KBP1 binding protein 1 (SHKBP1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human SH3KBP1 binding protein 1 (SHKBP1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human SH3KBP1 binding protein 1 (SHKBP1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

SHKBP1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

SHKBP1 (untagged)-Human SH3KBP1 binding protein 1 (SHKBP1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit polyclonal antibody to SHKBP1 (SH3KBP1 binding protein 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 162 and 477 of SHKBP1 (Uniprot ID#Q8TBC3)

Transient overexpression lysate of SH3KBP1 binding protein 1 (SHKBP1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-SHKBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SHKBP1 antibody is: synthetic peptide directed towards the N-terminal region of Human SHKBP1. Synthetic peptide located within the following region: TVFAPILNFLRTKELDPRGVHGSSLLHEAQFYGLTPLVRRLQLREELDRS

SHKBP1 MS Standard C13 and N15-labeled recombinant protein (NP_612401)

Tag C-Myc/DDK
Expression Host HEK293

SHKBP1 (untagged)-Human SH3KBP1 binding protein 1 (SHKBP1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression of SHKBP1 (NM_138392) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of SHKBP1 (NM_138392) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of SHKBP1 (NM_138392) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack