Products

cDNA Clones (35)
Proteins (20)
Antibodies (12)
Jump to Filters
View as table Download
Thyroid Hormone Receptor beta (THRB) (NM_000461) Human Tagged ORF Clone
RC217873

USD 420.00

In Stock

THRB (Myc-DDK-tagged)-Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Thyroid Hormone Receptor beta (THRB) (NM_001128176) Human Tagged ORF Clone
RC225776

USD 420.00

In Stock

THRB (Myc-DDK-tagged)-Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Thyroid Hormone Receptor beta (THRB) (NM_001128177) Human Tagged ORF Clone
RC225777

USD 420.00

In Stock

THRB (Myc-DDK-tagged)-Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Thyroid Hormone Receptor beta (THRB) (NM_000461) Human Tagged ORF Clone
RG217873

USD 460.00

In Stock

THRB (GFP-tagged) - Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Thyroid Hormone Receptor beta (THRB) (NM_000461) Human Tagged ORF Clone Lentiviral Particle
RC217873L1V

USD 820.00

3 Weeks

Lenti ORF particles, THRB (Myc-DDK tagged) - Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_000461) Human Tagged ORF Clone Lentiviral Particle
RC217873L2V

USD 820.00

6 Weeks

Lenti ORF particles, THRB (mGFP-tagged) - Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128176) Human Tagged ORF Clone Lentiviral Particle
RC225776L1V

USD 820.00

3 Weeks

Lenti ORF particles, THRB (Myc-DDK tagged) - Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128176) Human Tagged ORF Clone Lentiviral Particle
RC225776L2V

USD 820.00

6 Weeks

Lenti ORF particles, THRB (mGFP-tagged) - Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128177) Human Tagged ORF Clone Lentiviral Particle
RC225777L1V

USD 820.00

3 Weeks

Lenti ORF particles, THRB (Myc-DDK tagged) - Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128177) Human Tagged ORF Clone Lentiviral Particle
RC225777L2V

USD 820.00

6 Weeks

Lenti ORF particles, THRB (mGFP-tagged) - Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_000461) Human Untagged Clone
SC119844

USD 760.00

In Stock

THRB (untagged)-Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Thyroid Hormone Receptor beta (THRB) (NM_000461) Human Tagged ORF Clone Lentiviral Particle
RC217873L3V

USD 820.00

3 Weeks

Lenti ORF particles, THRB (Myc-DDK tagged) - Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_000461) Human Tagged ORF Clone Lentiviral Particle
RC217873L4V

USD 820.00

3 Weeks

Lenti ORF particles, THRB (mGFP-tagged) - Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128176) Human Tagged ORF Clone
RC225776L3

USD 620.00

3 Weeks

Lenti ORF clone of Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128176) Human Tagged ORF Clone Lentiviral Particle
RC225776L3V

USD 820.00

6 Weeks

Lenti ORF particles, THRB (Myc-DDK tagged) - Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128176) Human Tagged ORF Clone
RC225776L4

USD 620.00

3 Weeks

Lenti ORF clone of Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128176) Human Tagged ORF Clone Lentiviral Particle
RC225776L4V

USD 820.00

6 Weeks

Lenti ORF particles, THRB (mGFP-tagged) - Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128177) Human Tagged ORF Clone
RC225777L3

USD 620.00

3 Weeks

Lenti ORF clone of Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128177) Human Tagged ORF Clone Lentiviral Particle
RC225777L3V

USD 820.00

6 Weeks

Lenti ORF particles, THRB (Myc-DDK tagged) - Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128177) Human Tagged ORF Clone
RC225777L4

USD 620.00

3 Weeks

Lenti ORF clone of Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128177) Human Tagged ORF Clone Lentiviral Particle
RC225777L4V

USD 820.00

6 Weeks

Lenti ORF particles, THRB (mGFP-tagged) - Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128176) Human Tagged ORF Clone
RG225776

USD 460.00

3 Weeks

THRB (GFP-tagged) - Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128177) Human Tagged ORF Clone
RG225777

USD 460.00

3 Weeks

THRB (GFP-tagged) - Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Thyroid Hormone Receptor beta (THRB) (NM_000461) Human Tagged ORF Clone
RC217873L1

USD 768.00

In Stock

Lenti ORF clone of Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) Rabbit Polyclonal Antibody
TA327090

USD 275.00

3 Weeks

Rabbit anti-THRB Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human THRB
Thyroid Hormone Receptor beta (THRB) Rabbit Polyclonal Antibody
TA347621

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-THR1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-THR1 Antibody: A synthesized peptide derived from human THR1
Thyroid Hormone Receptor beta (THRB) (NM_000461) Human Tagged ORF Clone
RC217873L2

USD 620.00

3 Weeks

Lenti ORF clone of Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128176) Human Tagged ORF Clone
RC225776L1

USD 620.00

In Stock

Lenti ORF clone of Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128176) Human Tagged ORF Clone
RC225776L2

USD 620.00

3 Weeks

Lenti ORF clone of Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128177) Human Tagged ORF Clone
RC225777L1

USD 620.00

In Stock

Lenti ORF clone of Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128177) Human Tagged ORF Clone
RC225777L2

USD 620.00

3 Weeks

Lenti ORF clone of Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Thyroid Hormone Receptor beta (THRB) (NM_001128177) Human Recombinant Protein
TP761476

USD 215.00

In Stock

Purified recombinant protein of Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
Thyroid Hormone Receptor beta (THRB) (NM_000461) Human Over-expression Lysate
LY400163

USD 605.00

5 Days

Transient overexpression lysate of thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Thyroid Hormone Receptor beta (THRB) Rabbit Polyclonal Antibody
TA311778

USD 345.00

4 Weeks

Rabbit polyclonal Thyroid Hormone Receptor Beta antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Thyroid Hormone Receptor β antibody.
Modifications Phospho-specific
Thyroid Hormone Receptor beta (THRB) Rabbit Polyclonal Antibody
TA319140

USD 530.00

5 Days

Rabbit polyclonal Thyroid Hormone Receptor beta 1 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Anti-TR β1 antibody is affinity purified from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminal of human THRB isoform 1 protein.
Thyroid Hormone Receptor beta (THRB) Rabbit Polyclonal Antibody
TA335177

USD 375.00

5 Days

Rabbit Polyclonal Anti-THRB Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THRB antibody: synthetic peptide directed towards the N terminal of human THRB. Synthetic peptide located within the following region: MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK
Thyroid Hormone Receptor beta (THRB) Rabbit Polyclonal Antibody
TA341821

USD 310.00

5 Days

Rabbit Polyclonal Anti-Thrb Antibody

Applications Assay, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Thrb antibody: synthetic peptide directed towards the N terminal of mouse Thrb. Synthetic peptide located within the following region: KSKDSDLDMALSQSSQPAHLPEEKPFPQVQSPPHSQKKGYIPSYLDKDEL
Thyroid Hormone Receptor beta (THRB) (NM_001128176) Human Untagged Clone
SC323079

USD 760.00

2 Weeks

THRB (untagged)-Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Thyroid Hormone Receptor beta (THRB) Goat Polyclonal Antibody
TA303268

USD 375.00

5 Days

Goat Polyclonal Antibody against THRB

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-REELQKSIGHKP, from the internal region of the protein sequence according to NP_000452.2.
Thyroid Hormone Receptor beta (THRB) Rabbit Polyclonal Antibody
TA311779

USD 345.00

4 Weeks

Rabbit polyclonal TR-β1 (Ser142) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human TR-β1 around the phosphorylation site of serine 142 (H-P-SP-Y-S).
Modifications Phospho-specific
Thyroid Hormone Receptor beta (THRB) Rabbit Polyclonal Antibody
TA335178

USD 375.00

5 Days

Rabbit Polyclonal Anti-THRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THRB antibody: synthetic peptide directed towards the middle region of human THRB. Synthetic peptide located within the following region: YQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKV
Thyroid Hormone Receptor beta (THRB) Rabbit Polyclonal Antibody
TA339055

USD 375.00

5 Days

Rabbit Polyclonal Anti-THRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THRB antibody: synthetic peptide directed towards the N terminal of human THRB. Synthetic peptide located within the following region: QSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLD
Thyroid Hormone Receptor beta (THRB) Rabbit Polyclonal Antibody
TA339056

USD 375.00

5 Days

Rabbit Polyclonal Anti-THRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THRB antibody: synthetic peptide directed towards the N terminal of human THRB. Synthetic peptide located within the following region: LHRKSHSERRSTLKNEQSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTF