CYP2C9 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP2C9 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP2C9 (GFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, CYP2C9 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, CYP2C9 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, CYP2C9 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, CYP2C9 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CYP2C9 (untagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CYP2C9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2C9 antibody: synthetic peptide directed towards the C terminal of human CYP2C9. Synthetic peptide located within the following region: AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV |
CYP2C9 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CYP2C9 (untagged)-Homo sapiens, Similar to cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 9, clone MGC:22601 IMAGE:4766890, complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) CYP2C9 mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CYP2C9 mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) CYP2C9 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CYP2C9 MS Standard C13 and N15-labeled recombinant protein (NP_000762)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-CYP2C9 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP2C9 |
USD 379.00
In Stock
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI3D2 (formerly 3D2), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI3D2 (formerly 3D2), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of CYP2C9 (NM_000771) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP2C9 (NM_000771) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP2C9 (NM_000771) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack