CYP11B1 (Myc-DDK-tagged)-Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP11B1 (Myc-DDK-tagged)-Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP11B1 (Myc-DDK-tagged)-Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CYP11B1 (Myc-DDK tagged) - Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CYP11B1 (mGFP-tagged) - Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CYP11B1 (GFP-tagged) - Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CYP11B1 (Myc-DDK tagged) - Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP11B1 (mGFP-tagged) - Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP11B1 (Myc-DDK tagged) - Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP11B1 (mGFP-tagged) - Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CYP11B1 (GFP-tagged) - Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CYP11B1 (untagged)-Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal Cytochrome P450 11B1/2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Cytochrome P450 11B1/2. |
Rabbit Polyclonal Anti-CYP11B1 Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the C terminal of human CYP11B1. Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL |
CYP11B1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-CYP11B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the middle region of human CYP11B1. Synthetic peptide located within the following region: LALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPK |
CYP11B1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CYP11B1 MS Standard C13 and N15-labeled recombinant protein (NP_001021384)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CYP11B1 (untagged)-Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CYP11B1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP11B1 |
Transient overexpression of CYP11B1 (NM_000497) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP11B1 (NM_001026213) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP11B1 (NM_000497) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP11B1 (NM_000497) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CYP11B1 (NM_001026213) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP11B1 (NM_001026213) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack