Products

View as table Download

Rabbit polyclonal anti-PTPN22 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PTPN22.

Rabbit Polyclonal Anti-PTPN22 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PTPN22 Antibody: A synthesized peptide derived from human PTPN22

Rabbit Polyclonal Anti-PTPN22 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTPN22 antibody is: synthetic peptide directed towards the middle region of Human PTPN22. Synthetic peptide located within the following region: TAPRIDDEIPPPLPVWTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSL

Rabbit Polyclonal Anti-PTPN22 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PTPN22