USD 98.00
USD 390.00
In Stock
PSPH (Myc-DDK-tagged)-Human phosphoserine phosphatase (PSPH)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 98.00
USD 390.00
In Stock
PSPH (Myc-DDK-tagged)-Human phosphoserine phosphatase (PSPH)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
6 Weeks
Lenti ORF particles, PSPH (Myc-DDK tagged) - Human phosphoserine phosphatase (PSPH), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, PSPH (mGFP-tagged) - Human phosphoserine phosphatase (PSPH), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human phosphoserine phosphatase (PSPH)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PSPH (GFP-tagged) - Human phosphoserine phosphatase (PSPH)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phosphoserine phosphatase (PSPH), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PSPH (Myc-DDK tagged) - Human phosphoserine phosphatase (PSPH), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PSPH (mGFP-tagged) - Human phosphoserine phosphatase (PSPH), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phosphoserine phosphatase (PSPH), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PSPH (untagged)-Human phosphoserine phosphatase (PSPH)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal antibody to PSPH (phosphoserine phosphatase)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 175 of PSPH (Uniprot ID#P78330) |
Lenti ORF clone of Human phosphoserine phosphatase (PSPH), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human phosphoserine phosphatase (PSPH), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 121.00
In Stock
PSPH HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Goat Anti-PSPH Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RQQVKDNAKWYITD, from the C-Terminus of the protein sequence according to NP_004568.2. |
Rabbit polyclonal Anti-PSPH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSPH antibody: synthetic peptide directed towards the middle region of human PSPH. Synthetic peptide located within the following region: PSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVA |
Rabbit polyclonal Anti-PSPH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSPH antibody: synthetic peptide directed towards the middle region of human PSPH. Synthetic peptide located within the following region: IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE |
USD 396.00
5 Days
Transient overexpression lysate of phosphoserine phosphatase (PSPH)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PSPH MS Standard C13 and N15-labeled recombinant protein (NP_004568)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Phosphoserine phosphatase (225 aa) human recombinant protein, 0.1 mg
Expression Host | E. coli |
Phosphoserine phosphatase (225 aa) human recombinant protein, 0.5 mg
Expression Host | E. coli |
(untagged)-Human phosphoserine phosphatase-like
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression of PSPH (NM_004577) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human phosphoserine phosphatase (PSPH)
Tag | C-His |
Expression Host | E. coli |
USD 1,900.00
3 Weeks
Recombinant protein of human phosphoserine phosphatase (PSPH)
Tag | C-His |
Expression Host | E. coli |
Recombinant protein of human phosphoserine phosphatase (PSPH)
Tag | C-His |
Expression Host | E. coli |
USD 2,800.00
3 Weeks
Recombinant protein of human phosphoserine phosphatase (PSPH)
Tag | C-His |
Expression Host | E. coli |
Transient overexpression of PSPH (NM_004577) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSPH (NM_004577) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack