Products

View as table Download

PPP3R1 (Myc-DDK-tagged)-Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PPP3R1 (GFP-tagged) - Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP3R1 (Myc-DDK tagged) - Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP3R1 (mGFP-tagged) - Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PPP3R1 (untagged)-Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression lysate of protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform (PPP3R1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PPP3R1 (untagged)-Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal Anti-PPP3R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP3R1 antibody: synthetic peptide directed towards the N terminal of human PPP3R1. Synthetic peptide located within the following region: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ

PPP3R1 / Calcineurin B (1-170, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

PPP3R1 / Calcineurin B (1-170, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

PPP3R1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression of PPP3R1 (NM_000945) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform (PPP3R1)

Tag N-His
Expression Host E. coli

Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform (PPP3R1)

Tag N-His
Expression Host E. coli

Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform (PPP3R1)

Tag N-His
Expression Host E. coli

Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform (PPP3R1)

Tag N-His
Expression Host E. coli

Transient overexpression of PPP3R1 (NM_000945) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of PPP3R1 (NM_000945) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack