Products

cDNA Clones (11)
Proteins (6)
Antibodies (2)
Jump to Filters
View as table Download
PPM1H (NM_020700) Human Tagged ORF Clone
RC217548

USD 480.00

In Stock

PPM1H (Myc-DDK-tagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1H (PPM1H)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPM1H (NM_020700) Human Tagged ORF Clone Lentiviral Particle
RC217548L1V

USD 880.00

3 Weeks

Lenti ORF particles, PPM1H (Myc-DDK tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1H (PPM1H), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PPM1H (NM_020700) Human Tagged ORF Clone Lentiviral Particle
RC217548L2V

USD 880.00

6 Weeks

Lenti ORF particles, PPM1H (mGFP-tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1H (PPM1H), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PPM1H (NM_020700) Human Tagged ORF Clone
RG217548

USD 530.00

In Stock

PPM1H (GFP-tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1H (PPM1H)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPM1H (NM_020700) Human Tagged ORF Clone
RC217548L3

USD 680.00

3 Weeks

Lenti ORF clone of Human protein phosphatase, Mg2+/Mn2+ dependent, 1H (PPM1H), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPM1H (NM_020700) Human Tagged ORF Clone Lentiviral Particle
RC217548L3V

USD 880.00

5 Weeks

Lenti ORF particles, PPM1H (Myc-DDK tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1H (PPM1H), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPM1H (NM_020700) Human Tagged ORF Clone
RC217548L4

USD 680.00

3 Weeks

Lenti ORF clone of Human protein phosphatase, Mg2+/Mn2+ dependent, 1H (PPM1H), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPM1H (NM_020700) Human Tagged ORF Clone Lentiviral Particle
RC217548L4V

USD 880.00

7 Weeks

Lenti ORF particles, PPM1H (mGFP-tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1H (PPM1H), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPM1H (NM_020700) Human Tagged ORF Clone
RC217548L1

USD 840.00

In Stock

Lenti ORF clone of Human protein phosphatase, Mg2+/Mn2+ dependent, 1H (PPM1H), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PPM1H (Center) Rabbit Polyclonal Antibody
AP53413PU-N

USD 450.00

2 Weeks

PPM1H (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 235~263 amino acids from the Central region of Human PPM1H
PPM1H (NM_020700) Human Over-expression Lysate
LY412393

USD 605.00

In Stock

Transient overexpression lysate of protein phosphatase 1H (PP2C domain containing) (PPM1H)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPM1H (NM_020700) Human Tagged ORF Clone
RC217548L2

USD 680.00

3 Weeks

Lenti ORF clone of Human protein phosphatase, Mg2+/Mn2+ dependent, 1H (PPM1H), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PPM1H (NM_020700) Human Over-expression Lysate
LC412393

USD 187.00

In Stock

PPM1H HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPM1H Rabbit Polyclonal Antibody
TA331287

USD 375.00

5 Days

Rabbit Polyclonal Anti-PPM1H Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPM1H antibody is: synthetic peptide directed towards the N-terminal region of Human PPM1H. Synthetic peptide located within the following region: TRRLPWATGYAEVINAGKSTHNEDQASCEVLTVKKKAGAVTSTPNRNSSK
PPM1H (NM_020700) Human Mass Spec Standard
PH317548

USD 2,055.00

3 Weeks

PPM1H MS Standard C13 and N15-labeled recombinant protein (NP_065751)

Tag C-Myc/DDK
Expression Host HEK293
PPM1H (NM_020700) Human Untagged Clone
SC316540

USD 760.00

3 Weeks

PPM1H (untagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1H (PPM1H)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PPM1H (NM_020700) ICC Control Block
TB417548

USD 1,130.00

4 Weeks

Transient overexpression of PPM1H (NM_020700) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PPM1H Cytosection
TS417548

USD 225.00

4 Weeks

Transient overexpression of PPM1H (NM_020700) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PPM1H Cytosection
TS417548P5

USD 889.00

4 Weeks

Transient overexpression of PPM1H (NM_020700) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack