Germany
Japan
United Kingdom
China
USD 98.00
USD 390.00
In Stock
PSPH (Myc-DDK-tagged)-Human phosphoserine phosphatase (PSPH)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
6 Weeks
Lenti ORF particles, PSPH (Myc-DDK tagged) - Human phosphoserine phosphatase (PSPH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, PSPH (mGFP-tagged) - Human phosphoserine phosphatase (PSPH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human phosphoserine phosphatase (PSPH)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PSPH (GFP-tagged) - Human phosphoserine phosphatase (PSPH)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human phosphoserine phosphatase (PSPH), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PSPH (Myc-DDK tagged) - Human phosphoserine phosphatase (PSPH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, PSPH (mGFP-tagged) - Human phosphoserine phosphatase (PSPH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PSPH (untagged)-Human phosphoserine phosphatase (PSPH)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human phosphoserine phosphatase (PSPH), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human phosphoserine phosphatase (PSPH), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
USD 121.00
In Stock
PSPH HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Anti-PSPH Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RQQVKDNAKWYITD, from the C-Terminus of the protein sequence according to NP_004568.2. |
Rabbit polyclonal Anti-PSPH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSPH antibody: synthetic peptide directed towards the middle region of human PSPH. Synthetic peptide located within the following region: PSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVA |
Rabbit polyclonal Anti-PSPH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSPH antibody: synthetic peptide directed towards the middle region of human PSPH. Synthetic peptide located within the following region: IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE |
USD 396.00
5 Days
Transient overexpression lysate of phosphoserine phosphatase (PSPH)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PSPH MS Standard C13 and N15-labeled recombinant protein (NP_004568)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Phosphoserine phosphatase (225 aa) human recombinant protein, 0.1 mg
| Expression Host | E. coli |
Phosphoserine phosphatase (225 aa) human recombinant protein, 0.5 mg
| Expression Host | E. coli |
(untagged)-Human phosphoserine phosphatase-like
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression of PSPH (NM_004577) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human phosphoserine phosphatase (PSPH)
| Tag | C-His |
| Expression Host | E. coli |
USD 1,900.00
3 Weeks
Recombinant protein of human phosphoserine phosphatase (PSPH)
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human phosphoserine phosphatase (PSPH)
| Tag | C-His |
| Expression Host | E. coli |
USD 2,800.00
3 Weeks
Recombinant protein of human phosphoserine phosphatase (PSPH)
| Tag | C-His |
| Expression Host | E. coli |
Transient overexpression of PSPH (NM_004577) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSPH (NM_004577) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PSPH
Families
- Phosphatase