Products

View as table Download

SYNJ2 (GFP-tagged) - Human synaptojanin 2 (SYNJ2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, SYNJ2 (Myc-DDK tagged) - Human synaptojanin 2 (SYNJ2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

SYNJ2 (Myc-DDK-tagged)-Human synaptojanin 2 (SYNJ2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, SYNJ2 (Myc-DDK-tagged)-Human synaptojanin 2 (SYNJ2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

SYNJ2 (GFP-tagged) - Human synaptojanin 2 (SYNJ2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-SYNJ2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYNJ2 antibody: synthetic peptide directed towards the N terminal of human SYNJ2. Synthetic peptide located within the following region: SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL

SYNJ2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

SYNJ2 (untagged)-Human synaptojanin 2 (SYNJ2), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression lysate of synaptojanin 2 (SYNJ2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

SYNJ2 MS Standard C13 and N15-labeled recombinant protein (NP_003889)

Tag C-Myc/DDK
Expression Host HEK293

SYNJ2 (untagged)-Human synaptojanin 2 (SYNJ2) transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression of SYNJ2 (NM_003898) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of SYNJ2 (NM_001178088) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of SYNJ2 (NM_003898) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of SYNJ2 (NM_003898) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of SYNJ2 (NM_001178088) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack