SYNJ2 (Myc-DDK-tagged)-Human synaptojanin 2 (SYNJ2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SYNJ2 (Myc-DDK-tagged)-Human synaptojanin 2 (SYNJ2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SYNJ2 (GFP-tagged) - Human synaptojanin 2 (SYNJ2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human synaptojanin 2 (SYNJ2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,850.00
6 Weeks
Lenti ORF particles, SYNJ2 (Myc-DDK tagged) - Human synaptojanin 2 (SYNJ2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human synaptojanin 2 (SYNJ2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,850.00
6 Weeks
Lenti ORF particles, SYNJ2 (mGFP-tagged) - Human synaptojanin 2 (SYNJ2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SYNJ2 (Myc-DDK-tagged)-Human synaptojanin 2 (SYNJ2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of SYNJ2 (Myc-DDK-tagged)-Human synaptojanin 2 (SYNJ2), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,720.00
9 Weeks
Lenti ORF particles, SYNJ2 (Myc-DDK-tagged)-Human synaptojanin 2 (SYNJ2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of SYNJ2 (mGFP-tagged)-Human synaptojanin 2 (SYNJ2), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,720.00
9 Weeks
Lenti ORF particles, SYNJ2 (mGFP-tagged)-Human synaptojanin 2 (SYNJ2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SYNJ2 (GFP-tagged) - Human synaptojanin 2 (SYNJ2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-SYNJ2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SYNJ2 antibody: synthetic peptide directed towards the N terminal of human SYNJ2. Synthetic peptide located within the following region: SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL |
SYNJ2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
SYNJ2 (untagged)-Human synaptojanin 2 (SYNJ2), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of synaptojanin 2 (SYNJ2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
SYNJ2 MS Standard C13 and N15-labeled recombinant protein (NP_003889)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
SYNJ2 (untagged)-Human synaptojanin 2 (SYNJ2) transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression of SYNJ2 (NM_003898) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SYNJ2 (NM_001178088) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SYNJ2 (NM_003898) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SYNJ2 (NM_003898) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SYNJ2 (NM_001178088) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack