Products

cDNA Clones (8)
Proteins (5)
Antibodies (2)
Jump to Filters
View as table Download
GGT7 (NM_178026) Human Tagged ORF Clone
RC220619

USD 420.00

In Stock

GGT7 (Myc-DDK-tagged)-Human gamma-glutamyltransferase 7 (GGT7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GGT7 (NM_178026) Human Tagged ORF Clone
RG220619

USD 460.00

In Stock

GGT7 (GFP-tagged) - Human gamma-glutamyltransferase 7 (GGT7)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GGT7 (NM_178026) Human Tagged ORF Clone
RC220619L3

USD 620.00

3 Weeks

Lenti-ORF clone of GGT7 (Myc-DDK-tagged)-Human gamma-glutamyltransferase 7 (GGT7)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GGT7 (NM_178026) Human Tagged ORF Clone
RC220619L4

USD 620.00

3 Weeks

Lenti-ORF clone of GGT7 (mGFP-tagged)-Human gamma-glutamyltransferase 7 (GGT7)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GGT7 (NM_178026) Human Tagged ORF Clone Lentiviral Particle
RC220619L4V

USD 820.00

6 Weeks

Lenti ORF particles, GGT7 (mGFP-tagged)-Human gamma-glutamyltransferase 7 (GGT7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GGT7 Rabbit Polyclonal Antibody
TA313921

USD 345.00

In Stock

Rabbit polyclonal Gamma-glutamyltransferase 4 (heavy chain, Cleaved-Thr472) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Gamma-glutamyltransferase 4.
GGT7 (NM_178026) Human Over-expression Lysate
LC406022

USD 121.00

In Stock

GGT7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GGT7 (NM_178026) Human Over-expression Lysate
LY406022

USD 396.00

In Stock

Transient overexpression lysate of gamma-glutamyltransferase 7 (GGT7)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GGT7 (AK090413) Human Untagged Clone
SC126889

USD 960.00

In Stock

(untagged)-Human mRNA for FLJ00311 protein

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GGT7 Rabbit Polyclonal Antibody
TA331009

USD 375.00

5 Days

Rabbit polyclonal Anti-GGTL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GGTL3 antibody: synthetic peptide directed towards the C terminal of human GGTL3. Synthetic peptide located within the following region: ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC
GGT7 (NM_178026) Human Untagged Clone
SC318128

USD 760.00

3 Weeks

GGT7 (untagged)-Human gamma-glutamyltransferase 7 (GGT7)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GGT7 ICC Control Block
TB420619

USD 1,070.00

4 Weeks

Transient overexpression of GGT7 (NM_178026) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GGT7 Cytosection
TS420619

USD 225.00

4 Weeks

Transient overexpression of GGT7 (NM_178026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GGT7 Cytosection
TS420619P5

USD 889.00

4 Weeks

Transient overexpression of GGT7 (NM_178026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack