UQCRC2 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
UQCRC2 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 420.00
In Stock
UQCRC1 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase core protein I (UQCRC1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, UQCRC2 (Myc-DDK tagged) - Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, UQCRC2 (mGFP-tagged) - Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
3 Weeks
Lenti ORF particles, UQCRC1 (Myc-DDK tagged) - Human ubiquinol-cytochrome c reductase core protein I (UQCRC1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, UQCRC1 (mGFP-tagged) - Human ubiquinol-cytochrome c reductase core protein I (UQCRC1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 460.00
In Stock
UQCRC1 (GFP-tagged) - Human ubiquinol-cytochrome c reductase core protein I (UQCRC1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UQCRC2 (Myc-DDK tagged) - Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UQCRC2 (mGFP-tagged) - Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 620.00
3 Weeks
Lenti ORF clone of Human ubiquinol-cytochrome c reductase core protein I (UQCRC1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, UQCRC1 (Myc-DDK tagged) - Human ubiquinol-cytochrome c reductase core protein I (UQCRC1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 620.00
3 Weeks
Lenti ORF clone of Human ubiquinol-cytochrome c reductase core protein I (UQCRC1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, UQCRC1 (mGFP-tagged) - Human ubiquinol-cytochrome c reductase core protein I (UQCRC1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
UQCRC2 (GFP-tagged) - Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 768.00
In Stock
Lenti ORF clone of Human ubiquinol-cytochrome c reductase core protein I (UQCRC1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 415.00
In Stock
Rabbit Polyclonal antibody to UQCRC1 (ubiquinol-cytochrome c reductase core protein I)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of UQCRC1 (Uniprot ID#P31930) |
USD 121.00
In Stock
UQCRC1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF clone of Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 620.00
3 Weeks
Lenti ORF clone of Human ubiquinol-cytochrome c reductase core protein I (UQCRC1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
UQCRC2 (untagged)-Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
USD 310.00
In Stock
UQCRC1 (untagged)-Human ubiquinol-cytochrome c reductase core protein I (UQCRC1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 310.00
In Stock
UQCRC1 (untagged)-Human ubiquinol-cytochrome c reductase core protein I (UQCRC1)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
USD 215.00
In Stock
Recombinant protein of human ubiquinol-cytochrome c reductase core protein I (UQCRC1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
USD 396.00
5 Days
Transient overexpression lysate of ubiquinol-cytochrome c reductase core protein I (UQCRC1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of ubiquinol-cytochrome c reductase core protein II (UQCRC2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-UQCRC2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV |
USD 1,105.00
2 Weeks
UQCRC2 (Complex III subunit Core 2) (15-453, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
UQCRC2 (Complex III subunit Core 2) (15-453, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
UQCRC1 (Complex III subunit core 1) (35-480, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
UQCRC1 (Complex III subunit core 1) (35-480, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) UQCRC1 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) UQCRC1 mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
Applications | FC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) UQCRC1 mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
UQCRC2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 345.00
In Stock
Rabbit Polyclonal Anti-UQCRC1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UQCRC1 |
Rabbit Polyclonal Anti-UQCRC2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UQCRC2 |
USD 379.00
In Stock
UQCRC1 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
UQCRC1 mouse monoclonal antibody,clone 1G2, Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
UQCRC1 mouse monoclonal antibody,clone 1G2, HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
UQCRC1 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
UQCRC1 mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
Applications | FC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
UQCRC1 mouse monoclonal antibody,clone 1A3, Biotinylated
Applications | FC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
UQCRC1 mouse monoclonal antibody,clone 1A3, HRP conjugated
Applications | FC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
UQCRC1 mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
Applications | FC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
UQCRC1 mouse monoclonal antibody,clone 1G6, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |