CPXM1 (Myc-DDK-tagged)-Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CPXM1 (Myc-DDK-tagged)-Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CPXM1 (Myc-DDK-tagged)-Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CPXM1 (Myc-DDK tagged) - Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CPXM1 (mGFP-tagged) - Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human carboxypeptidase X (M14 family), member 1 (CPXM1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF clone of Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CPXM1 (Myc-DDK tagged) - Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CPXM1 (mGFP-tagged) - Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
6 Weeks
Lenti ORF particles, CPXM1 (Myc-DDK tagged) - Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
6 Weeks
Lenti ORF particles, CPXM1 (mGFP-tagged) - Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CPXM1 (GFP-tagged) - Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CPXM1 (GFP-tagged) - Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CPXM1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CPXM1 antibody: synthetic peptide directed towards the middle region of human CPXM1. Synthetic peptide located within the following region: MNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMG |
Lenti ORF clone of Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CPXM1 (untagged)-Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CPXM1 (untagged)-Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of carboxypeptidase X (M14 family), member 1 (CPXM1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CPXM1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CPXM1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CPXM1 MS Standard C13 and N15-labeled recombinant protein (NP_062555)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CPXM1 (untagged)-Human carboxypeptidase X (M14 family) member 1 (CPXM1) transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of CPXM1 (NM_019609) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CPXM1 (NM_001184699) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CPXM1 (NM_019609) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CPXM1 (NM_019609) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CPXM1 (NM_001184699) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CPXM1 (NM_001184699) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack