Products

cDNA Clones (19)
Proteins (12)
Antibodies (1)
Jump to Filters
View as table Download
CPXM (CPXM1) (NM_019609) Human Tagged ORF Clone
RC209394

USD 420.00

In Stock

CPXM1 (Myc-DDK-tagged)-Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CPXM (CPXM1) (NM_001184699) Human Tagged ORF Clone
RC230406

USD 600.00

In Stock

CPXM1 (Myc-DDK-tagged)-Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CPXM (CPXM1) (NM_019609) Human Tagged ORF Clone Lentiviral Particle
RC209394L1V

USD 820.00

3 Weeks

Lenti ORF particles, CPXM1 (Myc-DDK tagged) - Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CPXM (CPXM1) (NM_019609) Human Tagged ORF Clone Lentiviral Particle
RC209394L2V

USD 820.00

6 Weeks

Lenti ORF particles, CPXM1 (mGFP-tagged) - Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CPXM (CPXM1) (NM_019609) Human Tagged ORF Clone
RC209394L3

USD 620.00

3 Weeks

Lenti ORF clone of Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPXM (CPXM1) (NM_019609) Human Tagged ORF Clone Lentiviral Particle
RC209394L3V

USD 820.00

5 Weeks

Lenti ORF particles, CPXM1 (Myc-DDK tagged) - Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPXM (CPXM1) (NM_019609) Human Tagged ORF Clone
RC209394L4

USD 620.00

3 Weeks

Lenti ORF clone of Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPXM (CPXM1) (NM_019609) Human Tagged ORF Clone Lentiviral Particle
RC209394L4V

USD 820.00

7 Weeks

Lenti ORF particles, CPXM1 (mGFP-tagged) - Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPXM (CPXM1) (NM_001184699) Human Tagged ORF Clone
RC230406L3

USD 800.00

3 Weeks

Lenti ORF clone of Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPXM (CPXM1) (NM_001184699) Human Tagged ORF Clone Lentiviral Particle
RC230406L3V

USD 1,000.00

6 Weeks

Lenti ORF particles, CPXM1 (Myc-DDK tagged) - Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPXM (CPXM1) (NM_001184699) Human Tagged ORF Clone
RC230406L4

USD 800.00

3 Weeks

Lenti ORF clone of Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPXM (CPXM1) (NM_001184699) Human Tagged ORF Clone Lentiviral Particle
RC230406L4V

USD 1,000.00

6 Weeks

Lenti ORF particles, CPXM1 (mGFP-tagged) - Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPXM (CPXM1) (NM_019609) Human Tagged ORF Clone
RG209394

USD 460.00

3 Weeks

CPXM1 (GFP-tagged) - Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CPXM (CPXM1) (NM_001184699) Human Tagged ORF Clone
RG230406

USD 660.00

3 Weeks

CPXM1 (GFP-tagged) - Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CPXM (CPXM1) (NM_019609) Human Tagged ORF Clone
RC209394L1

USD 620.00

In Stock

Lenti ORF clone of Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CPXM (CPXM1) Rabbit Polyclonal Antibody
TA344817

USD 475.00

5 Days

Rabbit Polyclonal Anti-CPXM1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPXM1 antibody: synthetic peptide directed towards the middle region of human CPXM1. Synthetic peptide located within the following region: MNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMG
CPXM (CPXM1) (NM_019609) Human Tagged ORF Clone
RC209394L2

USD 620.00

3 Weeks

Lenti ORF clone of Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CPXM (CPXM1) (NM_019609) Human Untagged Clone
SC113268

USD 310.00

In Stock

CPXM1 (untagged)-Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CPXM (CPXM1) (NM_019609) Human Untagged Clone
SC324244

USD 310.00

In Stock

CPXM1 (untagged)-Human carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
CPXM (CPXM1) (NM_019609) Human Over-expression Lysate
LY412734

USD 396.00

5 Days

Transient overexpression lysate of carboxypeptidase X (M14 family), member 1 (CPXM1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CPXM (CPXM1) (NM_019609) Human Over-expression Lysate
LC412734

USD 121.00

2 Weeks

CPXM1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CPXM (CPXM1) (NM_001184699) Human Over-expression Lysate
LC433406

USD 121.00

2 Weeks

CPXM1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CPXM (CPXM1) (NM_001184699) Human Over-expression Lysate
LY433406

USD 396.00

5 Days

Transient overexpression lysate of carboxypeptidase X (M14 family), member 1 (CPXM1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CPXM (CPXM1) (NM_019609) Human Mass Spec Standard
PH309394

USD 2,055.00

3 Weeks

CPXM1 MS Standard C13 and N15-labeled recombinant protein (NP_062555)

Tag C-Myc/DDK
Expression Host HEK293
CPXM (CPXM1) (NM_001184699) Human Untagged Clone
SC329044

USD 1,110.00

3 Weeks

CPXM1 (untagged)-Human carboxypeptidase X (M14 family) member 1 (CPXM1) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CPXM (CPXM1) (NM_019609) ICC Control Block
TB409394

USD 1,070.00

4 Weeks

Transient overexpression of CPXM1 (NM_019609) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CPXM (CPXM1) (NM_001184699) ICC Control Block
TB430406

USD 1,250.00

4 Weeks

Transient overexpression of CPXM1 (NM_001184699) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CPXM (CPXM1) Cytosection
TS409394

USD 225.00

4 Weeks

Transient overexpression of CPXM1 (NM_019609) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CPXM (CPXM1) Cytosection
TS409394P5

USD 889.00

4 Weeks

Transient overexpression of CPXM1 (NM_019609) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CPXM (CPXM1) Cytosection
TS430406

USD 225.00

4 Weeks

Transient overexpression of CPXM1 (NM_001184699) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CPXM (CPXM1) Cytosection
TS430406P5

USD 889.00

4 Weeks

Transient overexpression of CPXM1 (NM_001184699) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack