Products

Primary Antibodies (2)
View as table Download

Rabbit Polyclonal Anti-EPHB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPHB3 antibody is: synthetic peptide directed towards the C-terminal region of Human EPHB3. Synthetic peptide located within the following region: QLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQYI

Rabbit Polyclonal Anti-EPHB3 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EPHB3