Products

View as table Download

Rabbit Polyclonal Anti-CANT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: VAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEG

Rabbit Polyclonal Anti-CANT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY