Rabbit Polyclonal Anti-PDYN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pdyn antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLTVSGLRGKDDLEDEVALEEGYSALAKLLEPVLKELEKSRLLTSVPEEK |
Rabbit Polyclonal Anti-PDYN Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDYN antibody: synthetic peptide directed towards the middle region of human PDYN. Synthetic peptide located within the following region: SELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGE |
Germany
Japan
United Kingdom
China
