FGF11 (Myc-DDK-tagged)-Human fibroblast growth factor 11 (FGF11)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
FGF11 (Myc-DDK-tagged)-Human fibroblast growth factor 11 (FGF11)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
FGF11 (GFP-tagged) - Human fibroblast growth factor 11 (FGF11)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human fibroblast growth factor 11 (FGF11), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, FGF11 (Myc-DDK tagged) - Human fibroblast growth factor 11 (FGF11), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human fibroblast growth factor 11 (FGF11), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, FGF11 (mGFP-tagged) - Human fibroblast growth factor 11 (FGF11), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
FGF11 (untagged)-Human fibroblast growth factor 11 (FGF11)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-FGF11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FGF11 antibody is: synthetic peptide directed towards the N-terminal region of Human FGF11. Synthetic peptide located within the following region: LASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLC |
Rabbit Polyclonal Anti-FGF11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FGF11 antibody: synthetic peptide directed towards the N terminal of human FGF11. Synthetic peptide located within the following region: VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKL |
FGF11 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of fibroblast growth factor 11 (FGF11)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of FGF11 (NM_004112) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of FGF11 (NM_004112) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of FGF11 (NM_004112) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack