Products

cDNA Clones (31)
Proteins (25)
Antibodies (4)
Jump to Filters
View as table Download
CTRP1 (C1QTNF1) (NM_198594) Human Tagged ORF Clone
RC205811

USD 98.00

USD 390.00

In Stock

C1QTNF1 (Myc-DDK-tagged)-Human C1q and tumor necrosis factor related protein 1 (C1QTNF1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CTRP1 (C1QTNF1) (NM_030968) Human Tagged ORF Clone
RC221483

USD 420.00

In Stock

C1QTNF1 (Myc-DDK-tagged)-Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CTRP1 (C1QTNF1) (NM_198593) Human Tagged ORF Clone
RC222462

USD 420.00

In Stock

C1QTNF1 (Myc-DDK-tagged)-Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CTRP1 (C1QTNF1) (NM_030968) Human Tagged ORF Clone Lentiviral Particle
RC221483L1V

USD 820.00

3 Weeks

Lenti ORF particles, C1QTNF1 (Myc-DDK tagged) - Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CTRP1 (C1QTNF1) (NM_030968) Human Tagged ORF Clone Lentiviral Particle
RC221483L2V

USD 820.00

6 Weeks

Lenti ORF particles, C1QTNF1 (mGFP-tagged) - Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CTRP1 (C1QTNF1) (NM_030968) Human Tagged ORF Clone
RG221483

USD 460.00

In Stock

C1QTNF1 (GFP-tagged) - Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTRP1 (C1QTNF1) (NM_153372) Human Tagged ORF Clone
RC233633

USD 420.00

In Stock

C1QTNF1 (Myc-DDK tagged) - Homo sapiens C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CTRP1 (C1QTNF1) (NM_198594) Human Tagged ORF Clone
RG205811

USD 460.00

In Stock

C1QTNF1 (GFP-tagged) - Human C1q and tumor necrosis factor related protein 1 (C1QTNF1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTRP1 (C1QTNF1) (NM_198593) Human Tagged ORF Clone
RG222462

USD 460.00

In Stock

C1QTNF1 (GFP-tagged) - Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTRP1 (C1QTNF1) (NM_198594) Human Tagged ORF Clone
RC205811L3

USD 620.00

3 Weeks

Lenti ORF clone of Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTRP1 (C1QTNF1) (NM_198594) Human Tagged ORF Clone Lentiviral Particle
RC205811L3V

USD 820.00

5 Weeks

Lenti ORF particles, C1QTNF1 (Myc-DDK tagged) - Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTRP1 (C1QTNF1) (NM_198594) Human Tagged ORF Clone
RC205811L4

USD 620.00

3 Weeks

Lenti ORF clone of Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTRP1 (C1QTNF1) (NM_198594) Human Tagged ORF Clone Lentiviral Particle
RC205811L4V

USD 820.00

5 Weeks

Lenti ORF particles, C1QTNF1 (mGFP-tagged) - Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTRP1 (C1QTNF1) (NM_030968) Human Tagged ORF Clone
RC221483L3

USD 620.00

3 Weeks

Lenti ORF clone of Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTRP1 (C1QTNF1) (NM_030968) Human Tagged ORF Clone Lentiviral Particle
RC221483L3V

USD 820.00

5 Weeks

Lenti ORF particles, C1QTNF1 (Myc-DDK tagged) - Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTRP1 (C1QTNF1) (NM_030968) Human Tagged ORF Clone
RC221483L4

USD 620.00

3 Weeks

Lenti ORF clone of Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTRP1 (C1QTNF1) (NM_030968) Human Tagged ORF Clone Lentiviral Particle
RC221483L4V

USD 820.00

7 Weeks

Lenti ORF particles, C1QTNF1 (mGFP-tagged) - Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTRP1 (C1QTNF1) (NM_198593) Human Tagged ORF Clone
RC222462L3

USD 620.00

3 Weeks

Lenti ORF clone of Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTRP1 (C1QTNF1) (NM_198593) Human Tagged ORF Clone Lentiviral Particle
RC222462L3V

USD 820.00

6 Weeks

Lenti ORF particles, C1QTNF1 (Myc-DDK tagged) - Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTRP1 (C1QTNF1) (NM_198593) Human Tagged ORF Clone
RC222462L4

USD 620.00

3 Weeks

Lenti ORF clone of Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTRP1 (C1QTNF1) (NM_198593) Human Tagged ORF Clone Lentiviral Particle
RC222462L4V

USD 820.00

6 Weeks

Lenti ORF particles, C1QTNF1 (mGFP-tagged) - Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTRP1 (C1QTNF1) (NM_153372) Human Tagged ORF Clone
RG233633

USD 460.00

3 Weeks

C1QTNF1 (GFP-tagged) - Homo sapiens C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTRP1 (C1QTNF1) (NM_030968) Human Tagged ORF Clone
RC221483L1

USD 768.00

In Stock

Lenti ORF clone of Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CTRP1 (C1QTNF1) (NM_198594) Human Tagged ORF Clone
RC205811L2

USD 620.00

In Stock

Lenti ORF clone of Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CTRP1 (C1QTNF1) (NM_030968) Human Untagged Clone
SC108958

USD 310.00

In Stock

C1QTNF1 (untagged)-Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CTRP1 (C1QTNF1) Rabbit Polyclonal Antibody
TA306230

USD 430.00

5 Days

Rabbit Polyclonal CTRP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CTRP1 (NT) antibody was raised against a 15 amino acid peptide from near the amino-terminus of human CTRP1.
CTRP1 (C1QTNF1) (NM_030968) Human Tagged ORF Clone
RC221483L2

USD 620.00

3 Weeks

Lenti ORF clone of Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CTRP1 (C1QTNF1) (N-term) Rabbit Polyclonal Antibody
AP17159PU-N

USD 450.00

2 Weeks

CTRP1 (C1QTNF1) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human C1QTNF1
CTRP1 (C1QTNF1) (NM_198593) Human Over-expression Lysate
LC404797

USD 121.00

In Stock

C1QTNF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CTRP1 (C1QTNF1) (NM_198594) Human Over-expression Lysate
LC404798

USD 121.00

In Stock

C1QTNF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CTRP1 (C1QTNF1) (NM_030968) Human Over-expression Lysate
LC429769

USD 121.00

In Stock

C1QTNF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CTRP1 (C1QTNF1) (NM_198594) Human Untagged Clone
SC319620

USD 420.00

In Stock

C1QTNF1 (untagged)-Human C1q and tumor necrosis factor related protein 1 (C1QTNF1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
CTRP1 (C1QTNF1) (NM_198594) Human Recombinant Protein
TP720624

USD 330.00

3 Weeks

Purified recombinant protein of Human C1q and tumor necrosis factor related protein 1 (C1QTNF1)

Tag C-His
Expression Host HEK293
CTRP1 (C1QTNF1) (NM_198593) Human Untagged Clone
SC124955

USD 660.00

2 Weeks

C1QTNF1 (untagged)-Human C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CTRP1 (C1QTNF1) Rabbit Polyclonal Antibody
TA306229

USD 430.00

5 Days

Rabbit Polyclonal CTRP1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CTRP1 (IN) antibody was raised against a 16 amino acid peptide from near the center of human CTRP1.
CTRP1 (C1QTNF1) Rabbit Polyclonal Antibody
TA339574

USD 375.00

5 Days

Rabbit Polyclonal Anti-C1QTNF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1QTNF1 antibody: synthetic peptide directed towards the N terminal of human C1QTNF1. Synthetic peptide located within the following region: YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS
CTRP1 (C1QTNF1) (NM_030968) Human Over-expression Lysate
LC410632

USD 121.00

2 Weeks

C1QTNF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CTRP1 (C1QTNF1) (NM_198593) Human Over-expression Lysate
LY404797

USD 396.00

5 Days

Transient overexpression lysate of C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CTRP1 (C1QTNF1) (NM_198594) Human Over-expression Lysate
LY404798

USD 396.00

5 Days

Transient overexpression lysate of C1q and tumor necrosis factor related protein 1 (C1QTNF1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CTRP1 (C1QTNF1) (NM_030968) Human Over-expression Lysate
LY410632

USD 396.00

5 Days

Transient overexpression lysate of C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY410632 is the same product as LY429769.
CTRP1 (C1QTNF1) (NM_030968) Human Over-expression Lysate
LY429769

USD 396.00

5 Days

Transient overexpression lysate of C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CTRP1 (C1QTNF1) (NM_153372) Human Untagged Clone
SC333302

USD 310.00

3 Weeks

C1QTNF1 (untagged) - Homo sapiens C1q and tumor necrosis factor related protein 1 (C1QTNF1), transcript variant 3

Vector pCMV6 series
Tag Tag Free
CTRP1 (C1QTNF1) (NM_198594) ICC Control Block
TB405811

USD 1,040.00

4 Weeks

Transient overexpression of C1QTNF1 (NM_198594) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CTRP1 (C1QTNF1) (NM_030968) ICC Control Block
TB421483

USD 1,070.00

4 Weeks

Transient overexpression of C1QTNF1 (NM_030968) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CTRP1 (C1QTNF1) (NM_198593) ICC Control Block
TB422462

USD 1,070.00

4 Weeks

Transient overexpression of C1QTNF1 (NM_198593) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CTRP1 (C1QTNF1) (NM_153372) ICC Control Block
TB433633

USD 1,070.00

4 Weeks

Transient overexpression of C1QTNF1 (NM_153372) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CTRP1 (C1QTNF1) (NM_198594) Human Recombinant Protein
TP720624L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human C1q and tumor necrosis factor related protein 1 (C1QTNF1)

Tag C-His
Expression Host HEK293
CTRP1 (C1QTNF1) (NM_198594) Human Recombinant Protein
TP720624M

USD 760.00

3 Weeks

Purified recombinant protein of Human C1q and tumor necrosis factor related protein 1 (C1QTNF1)

Tag C-His
Expression Host HEK293