DLL1 (Myc-DDK-tagged)-Human delta-like 1 (Drosophila) (DLL1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DLL1 (Myc-DDK-tagged)-Human delta-like 1 (Drosophila) (DLL1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, DLL1 (Myc-DDK tagged) - Human delta-like 1 (Drosophila) (DLL1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
DLL1 (GFP-tagged) - Human delta-like 1 (Drosophila) (DLL1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, DLL1 (mGFP-tagged) - Human delta-like 1 (Drosophila) (DLL1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human delta-like 1 (Drosophila) (DLL1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human delta-like 1 (Drosophila) (DLL1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
DLL1 (untagged)-Human delta-like 1 (Drosophila) (DLL1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF particles, DLL1 (mGFP-tagged) - Human delta-like 1 (Drosophila) (DLL1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human delta-like 1 (Drosophila) (DLL1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of delta-like 1 (Drosophila) (DLL1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human delta-like 1 (Drosophila) (DLL1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF particles, DLL1 (Myc-DDK tagged) - Human delta-like 1 (Drosophila) (DLL1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human delta-like 1 (Drosophila) (DLL1).
Tag | Tag Free |
Expression Host | HEK293 |
DLL1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-DLL1 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLL1 antibody: synthetic peptide directed towards the N terminal of human DLL1. Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP |
Goat Anti-DLL1 Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ATQRHLTVGEEWSQD, from the internal region of the protein sequence according to NP_005609.3. |
DLL1 MS Standard C13 and N15-labeled recombinant protein (NP_005609)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of DLL1 (NM_005618) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DLL1 (NM_005618) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of DLL1 (NM_005618) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack