Products

View as table Download

Rabbit anti-WHSC1L1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WHSC1L1

Rabbit Polyclonal Anti-Wipf1 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Wipf1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Wipf1. Synthetic peptide located within the following region: MPVPPPPAPPPPPTFALANTEKPSLNKTEQAGRNALLSDISKGKKLKKTV

Goat Polyclonal Antibody against SETMAR

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence RWQKCVDCNGSYFD, from the C Terminus of the protein sequence according to NP_006506.

Rabbit polyclonal anti-SETMAR antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SETMAR.

Rabbit Polyclonal Anti-WHSC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-WHSC1 Antibody: synthetic peptide directed towards the N terminal of human WHSC1. Synthetic peptide located within the following region: KYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFG