Products

cDNA Clones (46)
Proteins (25)
Primary Antibodies (5)
Jump to Filters
View as table Download
CNBP Mouse Monoclonal Antibody [Clone ID: AT38F10]
AM50047PU-N

USD 340.00

2 Weeks

CNBP mouse monoclonal antibody, clone AT38F10, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
CNBP Mouse Monoclonal Antibody [Clone ID: AT38F10]
AM50047PU-S

USD 230.00

2 Weeks

CNBP mouse monoclonal antibody, clone AT38F10, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
CNBP Rabbit Polyclonal Antibody
TA324700

USD 450.00

5 Days

Rabbit polyclonal CNBP Antibody (Center)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This CNBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-118 amino acids from the Central region of human CNBP.
CNBP Goat Polyclonal Antibody
TA303103

USD 375.00

5 Days

Goat Polyclonal Antibody against CNBP

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence GESGHLARECTIE, from the C Terminus of the protein sequence according to NP_003409.1.
CNBP Rabbit Polyclonal Antibody
TA338232

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNBP antibody: synthetic peptide directed towards the N terminal of human CNBP. Synthetic peptide located within the following region: SSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLP