POLR3A (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
POLR3A (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
POLR3A (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of POLR3A (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, POLR3A (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of POLR3A (mGFP-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, POLR3A (mGFP-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
POLR3A (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-POLR3A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR3A antibody: synthetic peptide directed towards the middle region of human POLR3A. Synthetic peptide located within the following region: AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT |
Rabbit polyclonal antibody to POLR3A (polymerase (RNA) III (DNA directed) polypeptide A, 155kDa)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 182 and 482 of POLR3A (Uniprot ID#O14802) |
POLR3A rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
(untagged)-Human cDNA: FLJ21091 fis, clone CAS03642
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-RPC1 / POLR3A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPC1. |
Transient overexpression of POLR3A (NM_007055) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of POLR3A (NM_007055) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of POLR3A (NM_007055) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack