Rabbit Polyclonal Anti-FKRP Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FKRP Antibody: A synthesized peptide derived from human FKRP |
Rabbit Polyclonal Anti-FKRP Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FKRP Antibody: A synthesized peptide derived from human FKRP |
Rabbit polyclonal anti-FKRP antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human FKRP. |
Rabbit Polyclonal Anti-Fkrp Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Fkrp Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LDHRQDVEFPEHFLQPLVPLPFAGFMAQAPNNYRRFLELKFGPGVIENPE |
Rabbit Polyclonal Anti-Fkrp Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Fkrp Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FPEHFLQPLVPLPFAGFMAQAPNNYRRFLELKFGPGVIENPEYPNPALLS |
Rabbit anti FKRP Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-terminus of human FKRP protein. This sequence is identical to human, mouse and rat. |