Products

View as table Download

Rabbit Polyclonal Anti-FKRP Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-FKRP Antibody: A synthesized peptide derived from human FKRP

Rabbit polyclonal anti-FKRP antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human FKRP.

Rabbit Polyclonal Anti-Fkrp Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Fkrp Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LDHRQDVEFPEHFLQPLVPLPFAGFMAQAPNNYRRFLELKFGPGVIENPE

Rabbit Polyclonal Anti-Fkrp Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Fkrp Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FPEHFLQPLVPLPFAGFMAQAPNNYRRFLELKFGPGVIENPEYPNPALLS

Rabbit anti FKRP Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human FKRP protein. This sequence is identical to human, mouse and rat.