Rabbit Polyclonal Anti-NPTN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN |
Rabbit polyclonal anti-NPTN antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NPTN. |
Rabbit Polyclonal Anti-NPTN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: SAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRK |
Germany
Japan
United Kingdom
China
