ABCA7 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCA7 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ABCA7 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
ABCA7 (GFP-tagged) - Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-Abca7 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL |
ABCA7 (untagged)-Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal ABCA7 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ABCA7 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human ABCA7. |
Transient overexpression of ABCA7 (NM_019112) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ABCA7 (NM_019112) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ABCA7 (NM_019112) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack