Germany
Japan
United Kingdom
China
UGT2A3 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide A3 (UGT2A3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti-ORF clone of UGT2A3 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide A3 (UGT2A3)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, UGT2A3 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide A3 (UGT2A3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of UGT2A3 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide A3 (UGT2A3)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, UGT2A3 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide A3 (UGT2A3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
UGT2A3 (GFP-tagged) - Human UDP glucuronosyltransferase 2 family, polypeptide A3 (UGT2A3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-UGT2A3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the N terminal of human UGT2A3. Synthetic peptide located within the following region: NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN |
Rabbit Polyclonal Anti-UGT2A3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the middle region of human UGT2A3. Synthetic peptide located within the following region: GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR |
UGT2A3 (untagged)-Human UDP glucuronosyltransferase 2 family, polypeptide A3 (UGT2A3)
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of UGT2A3 (NM_024743) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UGT2A3 (NM_024743) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- UGT2A3
Families
- Transmembrane
Pathways
- Porphyrin and chlorophyll metabolism