Products

View as table Download

Rabbit polyclonal Anti-ALG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALG1 antibody: synthetic peptide directed towards the N terminal of human ALG1. Synthetic peptide located within the following region: VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG

Rabbit polyclonal Anti-ALG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALG1 antibody is: synthetic peptide directed towards the C-terminal region of Human ALG1. Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD