Germany
Japan
United Kingdom
China
ABCA7 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, ABCA7 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
ABCA7 (GFP-tagged) - Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-Abca7 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL |
ABCA7 (untagged)-Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression of ABCA7 (NM_019112) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ABCA7 (NM_019112) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ABCA7 (NM_019112) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ABCA7
Families
- Transmembrane