Products

cDNA Clones (10)
Proteins (6)
Antibodies (4)
Jump to Filters
View as table Download
CRLR (CALCRL) (NM_005795) Human Tagged ORF Clone
RC212215

USD 477.00

In Stock

CALCRL (Myc-DDK-tagged)-Human calcitonin receptor-like (CALCRL)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CRLR (CALCRL) (NM_001271751) Human Tagged ORF Clone
RC232791

USD 420.00

In Stock

CALCRL (Myc-DDK tagged) - Homo sapiens calcitonin receptor-like (CALCRL), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CRLR (CALCRL) (NM_005795) Human Tagged ORF Clone
RG212215

USD 460.00

2 Weeks

CALCRL (GFP-tagged) - Human calcitonin receptor-like (CALCRL)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CRLR (CALCRL) (NM_001271751) Human Tagged ORF Clone
RG232791

USD 460.00

3 Weeks

CALCRL (GFP-tagged) - Homo sapiens calcitonin receptor-like (CALCRL), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CRLR (CALCRL) Rabbit Polyclonal Antibody
TA346420

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-CALCRL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CALCRL antibody: synthetic peptide directed towards the N terminal of human CALCRL. Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL
CRLR (CALCRL) (NM_005795) Human Untagged Clone
SC116534

USD 770.00

In Stock

CALCRL (untagged)-Human calcitonin receptor-like (CALCRL)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CRLR (CALCRL) (NM_005795) Human Tagged ORF Clone
RC212215L4

USD 768.00

In Stock

Lenti-ORF clone of CALCRL (mGFP-tagged)-Human calcitonin receptor-like (CALCRL)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CRLR (CALCRL) Rabbit Polyclonal Antibody
TA316586

USD 425.00

In Stock

CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%).
CRLR (CALCRL) Rabbit Polyclonal Antibody
TA316587

USD 425.00

5 Days

CALCRL / CRLR Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Orang-Utan
Conjugation Unconjugated
Immunogen CALCRL / CGRP Receptor antibody was raised against synthetic 15 amino acid peptide from N-terminal extracellular domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Mouse, Rabbit (93%); Rat, Panda, Dog, Horse, Pig (87%); Goat, Bovine (80%).
CRLR (CALCRL) (NM_005795) Human Tagged ORF Clone
RC212215L3

USD 768.00

3 Weeks

Lenti-ORF clone of CALCRL (Myc-DDK-tagged)-Human calcitonin receptor-like (CALCRL)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CRLR (CALCRL) (NM_001271751) Human Untagged Clone
SC330964

USD 470.00

3 Weeks

CALCRL (untagged) - Homo sapiens calcitonin receptor-like (CALCRL), transcript variant 2

Vector pCMV6 series
Tag Tag Free
CRLR (CALCRL) Rabbit Polyclonal Antibody
TA351107

USD 345.00

In Stock

Rabbit Polyclonal Anti-CALCRL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CALCRL
CRLR (CALCRL) (NM_005795) ICC Control Block
TB412215

USD 1,070.00

4 Weeks

Transient overexpression of CALCRL (NM_005795) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CRLR (CALCRL) (NM_001271751) ICC Control Block
TB432791

USD 1,070.00

4 Weeks

Transient overexpression of CALCRL (NM_001271751) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CRLR (CALCRL) Cytosection
TS412215

USD 225.00

4 Weeks

Transient overexpression of CALCRL (NM_005795) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CRLR (CALCRL) Cytosection
TS412215P5

USD 889.00

4 Weeks

Transient overexpression of CALCRL (NM_005795) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CRLR (CALCRL) Cytosection
TS432791

USD 225.00

4 Weeks

Transient overexpression of CALCRL (NM_001271751) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CRLR (CALCRL) Cytosection
TS432791P5

USD 889.00

4 Weeks

Transient overexpression of CALCRL (NM_001271751) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack