Products

cDNA Clones (7)
Proteins (5)
Antibodies (1)
Jump to Filters
View as table Download
EDEM1 (NM_014674) Human Tagged ORF Clone
RC205655

USD 480.00

In Stock

EDEM1 (Myc-DDK-tagged)-Human ER degradation enhancer, mannosidase alpha-like 1 (EDEM1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
EDEM1 (NM_014674) Human Tagged ORF Clone
RG205655

USD 530.00

In Stock

EDEM1 (GFP-tagged) - Human ER degradation enhancer, mannosidase alpha-like 1 (EDEM1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EDEM1 (NM_014674) Human Tagged ORF Clone
RC205655L3

USD 680.00

3 Weeks

Lenti ORF clone of Human ER degradation enhancer, mannosidase alpha-like 1 (EDEM1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EDEM1 (NM_014674) Human Tagged ORF Clone Lentiviral Particle
RC205655L3V

USD 880.00

6 Weeks

Lenti ORF particles, EDEM1 (Myc-DDK tagged) - Human ER degradation enhancer, mannosidase alpha-like 1 (EDEM1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EDEM1 (NM_014674) Human Tagged ORF Clone
RC205655L4

USD 680.00

3 Weeks

Lenti ORF clone of Human ER degradation enhancer, mannosidase alpha-like 1 (EDEM1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EDEM1 (NM_014674) Human Tagged ORF Clone Lentiviral Particle
RC205655L4V

USD 880.00

6 Weeks

Lenti ORF particles, EDEM1 (mGFP-tagged) - Human ER degradation enhancer, mannosidase alpha-like 1 (EDEM1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EDEM1 (NM_014674) Human Untagged Clone
SC114903

USD 310.00

In Stock

EDEM1 (untagged)-Human ER degradation enhancer, mannosidase alpha-like 1 (EDEM1)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
EDEM1 Rabbit Polyclonal Antibody
TA341949

USD 375.00

5 Days

Rabbit Polyclonal Anti-EDEM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDEM1 antibody: synthetic peptide directed towards the N terminal of human EDEM1. Synthetic peptide located within the following region: MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI
EDEM1 (NM_014674) Human Over-expression Lysate
LC415128

USD 121.00

2 Weeks

EDEM1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EDEM1 (NM_014674) Human Over-expression Lysate
LY415128

USD 396.00

5 Days

Transient overexpression lysate of ER degradation enhancer, mannosidase alpha-like 1 (EDEM1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EDEM1 (NM_014674) ICC Control Block
TB405655

USD 1,130.00

4 Weeks

Transient overexpression of EDEM1 (NM_014674) in HEK293T cells paraffin embedded controls for ICC/IHC staining

EDEM1 Cytosection
TS405655

USD 225.00

4 Weeks

Transient overexpression of EDEM1 (NM_014674) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

EDEM1 Cytosection
TS405655P5

USD 889.00

4 Weeks

Transient overexpression of EDEM1 (NM_014674) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack