Products

cDNA Clones (18)
Proteins (14)
Antibodies (5)
Jump to Filters
View as table Download
FKRP (NM_024301) Human Tagged ORF Clone
RC200941

USD 420.00

In Stock

FKRP (Myc-DDK-tagged)-Human fukutin related protein (FKRP), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FKRP (NM_001039885) Human Tagged ORF Clone
RC222259

USD 420.00

In Stock

FKRP (Myc-DDK-tagged)-Human fukutin related protein (FKRP), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FKRP (NM_024301) Human Tagged ORF Clone Lentiviral Particle
RC200941L1V

USD 820.00

3 Weeks

Lenti ORF particles, FKRP (Myc-DDK tagged) - Human fukutin related protein (FKRP), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
FKRP (NM_024301) Human Tagged ORF Clone Lentiviral Particle
RC200941L2V

USD 820.00

6 Weeks

Lenti ORF particles, FKRP (mGFP-tagged) - Human fukutin related protein (FKRP), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
FKRP (NM_024301) Human Tagged ORF Clone
RG200941

USD 460.00

In Stock

FKRP (GFP-tagged) - Human fukutin related protein (FKRP), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FKRP (NM_024301) Human Tagged ORF Clone
RC200941L3

USD 620.00

3 Weeks

Lenti ORF clone of Human fukutin related protein (FKRP), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FKRP (NM_024301) Human Tagged ORF Clone Lentiviral Particle
RC200941L3V

USD 820.00

5 Weeks

Lenti ORF particles, FKRP (Myc-DDK tagged) - Human fukutin related protein (FKRP), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FKRP (NM_024301) Human Tagged ORF Clone
RC200941L4

USD 620.00

3 Weeks

Lenti ORF clone of Human fukutin related protein (FKRP), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FKRP (NM_024301) Human Tagged ORF Clone Lentiviral Particle
RC200941L4V

USD 820.00

7 Weeks

Lenti ORF particles, FKRP (mGFP-tagged) - Human fukutin related protein (FKRP), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FKRP (NM_001039885) Human Tagged ORF Clone
RC222259L3

USD 620.00

3 Weeks

Lenti ORF clone of Human fukutin related protein (FKRP), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FKRP (NM_001039885) Human Tagged ORF Clone Lentiviral Particle
RC222259L3V

USD 820.00

6 Weeks

Lenti ORF particles, FKRP (Myc-DDK tagged) - Human fukutin related protein (FKRP), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FKRP (NM_001039885) Human Tagged ORF Clone
RC222259L4

USD 620.00

3 Weeks

Lenti ORF clone of Human fukutin related protein (FKRP), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FKRP (NM_001039885) Human Tagged ORF Clone Lentiviral Particle
RC222259L4V

USD 820.00

6 Weeks

Lenti ORF particles, FKRP (mGFP-tagged) - Human fukutin related protein (FKRP), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FKRP (NM_001039885) Human Tagged ORF Clone
RG222259

USD 460.00

3 Weeks

FKRP (GFP-tagged) - Human fukutin related protein (FKRP), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FKRP (NM_024301) Human Tagged ORF Clone
RC200941L1

USD 768.00

In Stock

Lenti ORF clone of Human fukutin related protein (FKRP), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
FKRP (NM_024301) Human Untagged Clone
SC112266

USD 310.00

In Stock

FKRP (untagged)-Human fukutin related protein (FKRP), transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
FKRP Rabbit Polyclonal Antibody
TA347645

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-FKRP Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-FKRP Antibody: A synthesized peptide derived from human FKRP
FKRP Rabbit Polyclonal Antibody
TA315775

USD 345.00

4 Weeks

Rabbit polyclonal anti-FKRP antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human FKRP.
FKRP (NM_001039885) Human Over-expression Lysate
LC421845

USD 187.00

In Stock

FKRP HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FKRP (NM_024301) Human Tagged ORF Clone
RC200941L2

USD 620.00

3 Weeks

Lenti ORF clone of Human fukutin related protein (FKRP), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
FKRP (NM_024301) Human Over-expression Lysate
LY411322

USD 396.00

5 Days

Transient overexpression lysate of fukutin related protein (FKRP), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FKRP (NM_001039885) Human Untagged Clone
SC311019

USD 760.00

3 Weeks

FKRP (untagged)-Human fukutin related protein (FKRP), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
FKRP Rabbit Polyclonal Antibody
TA335471

USD 375.00

5 Days

Rabbit Polyclonal Anti-Fkrp Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Fkrp Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LDHRQDVEFPEHFLQPLVPLPFAGFMAQAPNNYRRFLELKFGPGVIENPE
FKRP Rabbit Polyclonal Antibody
TA335472

USD 375.00

5 Days

Rabbit Polyclonal Anti-Fkrp Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Fkrp Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FPEHFLQPLVPLPFAGFMAQAPNNYRRFLELKFGPGVIENPEYPNPALLS
FKRP Rabbit Polyclonal Antibody
TA354897

USD 355.00

5 Days

Rabbit anti FKRP Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human FKRP protein. This sequence is identical to human, mouse and rat.
FKRP (NM_024301) Human Over-expression Lysate
LC411322

USD 121.00

2 Weeks

FKRP HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FKRP (NM_001039885) Human Over-expression Lysate
LC425666

USD 121.00

2 Weeks

FKRP HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FKRP (NM_001039885) Human Over-expression Lysate
LY421845

USD 605.00

5 Days

Transient overexpression lysate of fukutin related protein (FKRP), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY421845 is the same product as LY425666.
FKRP (NM_001039885) Human Over-expression Lysate
LY425666

USD 396.00

5 Days

Transient overexpression lysate of fukutin related protein (FKRP), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FKRP (NM_024301) Human Mass Spec Standard
PH300941

USD 2,055.00

3 Weeks

FKRP MS Standard C13 and N15-labeled recombinant protein (NP_077277)

Tag C-Myc/DDK
Expression Host HEK293
FKRP (NM_024301) ICC Control Block
TB400941

USD 1,070.00

4 Weeks

Transient overexpression of FKRP (NM_024301) in HEK293T cells paraffin embedded controls for ICC/IHC staining

FKRP (NM_001039885) ICC Control Block
TB422259

USD 1,070.00

4 Weeks

Transient overexpression of FKRP (NM_001039885) in HEK293T cells paraffin embedded controls for ICC/IHC staining

FKRP Cytosection
TS400941

USD 225.00

4 Weeks

Transient overexpression of FKRP (NM_024301) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

FKRP Cytosection
TS400941P5

USD 889.00

4 Weeks

Transient overexpression of FKRP (NM_024301) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

FKRP Cytosection
TS422259

USD 225.00

4 Weeks

Transient overexpression of FKRP (NM_001039885) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

FKRP Cytosection
TS422259P5

USD 889.00

4 Weeks

Transient overexpression of FKRP (NM_001039885) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack