Products

cDNA Clones (11)
Proteins (4)
Antibodies (2)
Jump to Filters
View as table Download
GFRAL (NM_207410) Human Tagged ORF Clone
RC213001

USD 420.00

In Stock

GFRAL (Myc-DDK-tagged)-Human GDNF family receptor alpha like (GFRAL)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GFRAL (NM_207410) Human Tagged ORF Clone
RG213001

USD 460.00

In Stock

GFRAL (GFP-tagged) - Human GDNF family receptor alpha like (GFRAL)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GFRAL (NM_207410) Human Tagged ORF Clone Lentiviral Particle
RC213001L1V

USD 820.00

2 Weeks

Lenti ORF particles, GFRAL (Myc-DDK-tagged)-Human GDNF family receptor alpha like (GFRAL), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GFRAL (NM_207410) Human Tagged ORF Clone Lentiviral Particle
RC213001L2V

USD 820.00

2 Weeks

Lenti ORF particles, GFRAL (mGFP-tagged)-Human GDNF family receptor alpha like (GFRAL), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GFRAL (NM_207410) Human Tagged ORF Clone Lentiviral Particle
RC213001L4V

USD 820.00

3 Weeks

Lenti ORF particles, GFRAL (mGFP-tagged)-Human GDNF family receptor alpha like (GFRAL), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GFRAL (NM_207410) Human Tagged ORF Clone
RC213001L4

USD 620.00

In Stock

Lenti-ORF clone of GFRAL (mGFP-tagged)-Human GDNF family receptor alpha like (GFRAL)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GFRAL (NM_207410) Human Tagged Lenti ORF Clone
RC213001L1

USD 768.00

In Stock

Lenti-ORF clone of GFRAL (Myc-DDK-tagged)-Human GDNF family receptor alpha like (GFRAL)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GFRAL (NM_207410) Human Tagged Lenti ORF Clone
RC213001L2

USD 768.00

In Stock

Lenti-ORF clone of GFRAL (mGFP-tagged)-Human GDNF family receptor alpha like (GFRAL)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GFRAL (C-term) Rabbit Polyclonal Antibody
AP51826PU-N

USD 450.00

2 Weeks

GFRAL (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 366-394 amino acids from the C-terminal region of human GFRAL
GFRAL (NM_207410) Human Untagged Clone
SC308523

USD 670.00

In Stock

GFRAL (untagged)-Human GDNF family receptor alpha like (GFRAL)

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
GFRAL (NM_207410) Human Recombinant Protein
TP710385

USD 425.00

In Stock

Purified recombinant protein of Human GDNF family receptor alpha like (GFRAL), with C-terminal His tag, secretory expressed in Sf9 cells, 20ug

Tag C-His
Expression Host Sf9
GFRAL Rabbit Polyclonal Antibody
TA331490

USD 375.00

5 Days

Rabbit Polyclonal Anti-GFRAL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GFRAL Antibody is: synthetic peptide directed towards the N-terminal region of Human GFRAL. Synthetic peptide located within the following region: TDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVA
GFRAL (NM_207410) ICC Control Block
TB413001

USD 1,070.00

4 Weeks

Transient overexpression of GFRAL (NM_207410) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GFRAL Cytosection
TS413001

USD 225.00

4 Weeks

Transient overexpression of GFRAL (NM_207410) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GFRAL Cytosection
TS413001P5

USD 889.00

4 Weeks

Transient overexpression of GFRAL (NM_207410) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack