GFRAL (Myc-DDK-tagged)-Human GDNF family receptor alpha like (GFRAL)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
GFRAL (Myc-DDK-tagged)-Human GDNF family receptor alpha like (GFRAL)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GFRAL (GFP-tagged) - Human GDNF family receptor alpha like (GFRAL)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GFRAL (Myc-DDK-tagged)-Human GDNF family receptor alpha like (GFRAL), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GFRAL (Myc-DDK-tagged)-Human GDNF family receptor alpha like (GFRAL), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GFRAL (mGFP-tagged)-Human GDNF family receptor alpha like (GFRAL), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, GFRAL (mGFP-tagged)-Human GDNF family receptor alpha like (GFRAL), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GFRAL (mGFP-tagged)-Human GDNF family receptor alpha like (GFRAL)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GFRAL (Myc-DDK-tagged)-Human GDNF family receptor alpha like (GFRAL)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GFRAL (Myc-DDK-tagged)-Human GDNF family receptor alpha like (GFRAL)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti-ORF clone of GFRAL (mGFP-tagged)-Human GDNF family receptor alpha like (GFRAL)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
GFRAL (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 366-394 amino acids from the C-terminal region of human GFRAL |
GFRAL (untagged)-Human GDNF family receptor alpha like (GFRAL)
Vector | PCMV6-Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human GDNF family receptor alpha like (GFRAL), with C-terminal His tag, secretory expressed in Sf9 cells, 20ug
Tag | C-His |
Expression Host | Sf9 |
Rabbit Polyclonal Anti-GFRAL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GFRAL Antibody is: synthetic peptide directed towards the N-terminal region of Human GFRAL. Synthetic peptide located within the following region: TDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVA |
Transient overexpression of GFRAL (NM_207410) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GFRAL (NM_207410) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GFRAL (NM_207410) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack