Products

View as table Download

GFRAL (Myc-DDK-tagged)-Human GDNF family receptor alpha like (GFRAL)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GFRAL (GFP-tagged) - Human GDNF family receptor alpha like (GFRAL)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, GFRAL (Myc-DDK-tagged)-Human GDNF family receptor alpha like (GFRAL), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, GFRAL (mGFP-tagged)-Human GDNF family receptor alpha like (GFRAL), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, GFRAL (mGFP-tagged)-Human GDNF family receptor alpha like (GFRAL), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of GFRAL (mGFP-tagged)-Human GDNF family receptor alpha like (GFRAL)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of GFRAL (Myc-DDK-tagged)-Human GDNF family receptor alpha like (GFRAL)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti-ORF clone of GFRAL (mGFP-tagged)-Human GDNF family receptor alpha like (GFRAL)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

GFRAL (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 366-394 amino acids from the C-terminal region of human GFRAL

GFRAL (untagged)-Human GDNF family receptor alpha like (GFRAL)

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

Purified recombinant protein of Human GDNF family receptor alpha like (GFRAL), with C-terminal His tag, secretory expressed in Sf9 cells, 20ug

Tag C-His
Expression Host Sf9

Rabbit Polyclonal Anti-GFRAL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GFRAL Antibody is: synthetic peptide directed towards the N-terminal region of Human GFRAL. Synthetic peptide located within the following region: TDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVA

Transient overexpression of GFRAL (NM_207410) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of GFRAL (NM_207410) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of GFRAL (NM_207410) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack