Germany
Japan
United Kingdom
China
GPR173 (Myc-DDK-tagged)-Human G protein-coupled receptor 173 (GPR173)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
GPR173 (GFP-tagged) - Human G protein-coupled receptor 173 (GPR173)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human G protein-coupled receptor 173 (GPR173), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, GPR173 (Myc-DDK tagged) - Human G protein-coupled receptor 173 (GPR173), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human G protein-coupled receptor 173 (GPR173), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, GPR173 (mGFP-tagged) - Human G protein-coupled receptor 173 (GPR173), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GPR173 (untagged)-Human G protein-coupled receptor 173 (GPR173)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GPR173 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-GPR173 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR173. |
Transient overexpression lysate of G protein-coupled receptor 173 (GPR173)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-GPR173 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR173. |
Rabbit Polyclonal Anti-GPR173 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPR173 Antibody is: synthetic peptide directed towards the C-terminal region of Human GPR173. Synthetic peptide located within the following region: IRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWSPYIVACYWRV |
Rabbit Polyclonal Anti-GPR173 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GPR173 / SREB3 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human GPR173. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Rabbit (100%); Mouse, Rat, Hamster, Bovine (95%). |
Rabbit Polyclonal Anti-GPR173 Antibody (Transmembrane Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GPR173 / SREB3 antibody was raised against synthetic 19 amino acid peptide from 5th transmembrane domain of human GPR173. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Rabbit (100%); Opossum (95%). |
Rabbit Polyclonal Anti-GPR173 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GPR173 / SREB3 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human GPR173. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Rabbit (100%); Panda (95%); Hamster, Elephant (90%). |
Transient overexpression of GPR173 (NM_018969) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPR173 (NM_018969) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GPR173 (NM_018969) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GPR173
Families
- Transmembrane