Germany
Japan
United Kingdom
China
LRRTM1 (Myc-DDK-tagged)-Human leucine rich repeat transmembrane neuronal 1 (LRRTM1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, LRRTM1 (Myc-DDK tagged) - Human leucine rich repeat transmembrane neuronal 1 (LRRTM1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, LRRTM1 (mGFP-tagged) - Human leucine rich repeat transmembrane neuronal 1 (LRRTM1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
LRRTM1 (GFP-tagged) - Human leucine rich repeat transmembrane neuronal 1 (LRRTM1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human leucine rich repeat transmembrane neuronal 1 (LRRTM1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LRRTM1 (Myc-DDK tagged) - Human leucine rich repeat transmembrane neuronal 1 (LRRTM1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human leucine rich repeat transmembrane neuronal 1 (LRRTM1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LRRTM1 (mGFP-tagged) - Human leucine rich repeat transmembrane neuronal 1 (LRRTM1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human leucine rich repeat transmembrane neuronal 1 (LRRTM1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
LRRTM1 (untagged)-Human leucine rich repeat transmembrane neuronal 1 (LRRTM1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human leucine rich repeat transmembrane neuronal 1 (LRRTM1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
LRRTM1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of leucine rich repeat transmembrane neuronal 1 (LRRTM1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
LRRTM1 (untagged)-Human leucine rich repeat transmembrane neuronal 1 (LRRTM1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-LRRTM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LRRTM1 Antibody: synthetic peptide directed towards the middle region of human LRRTM1. Synthetic peptide located within the following region: RIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAH |
Rabbit Polyclonal Anti-LRRTM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LRRTM1 Antibody: synthetic peptide directed towards the middle region of human LRRTM1. Synthetic peptide located within the following region: CALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSG |
Carrier-free (BSA/glycerol-free) LRRTM1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) LRRTM1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LRRTM1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LRRTM1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LRRTM1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRTM1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), Biotinylated
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
LRRTM1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), HRP conjugated
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LRRTM1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LRRTM1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRTM1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
LRRTM1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LRRTM1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LRRTM1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRTM1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
LRRTM1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LRRTM1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LRRTM1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRTM1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
LRRTM1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LRRTM1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Transient overexpression of LRRTM1 (NM_178839) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LRRTM1 (NM_178839) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LRRTM1 (NM_178839) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- LRRTM1
Families
- Transmembrane