Lenti ORF particles, MAN1A2 (Myc-DDK tagged) - Human mannosidase, alpha, class 1A, member 2 (MAN1A2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
- LentiORF®
Lenti ORF particles, MAN1A2 (Myc-DDK tagged) - Human mannosidase, alpha, class 1A, member 2 (MAN1A2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, MAN1A2 (mGFP-tagged) - Human mannosidase, alpha, class 1A, member 2 (MAN1A2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
MAN1A2 (Myc-DDK-tagged)-Human mannosidase, alpha, class 1A, member 2 (MAN1A2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human mannosidase, alpha, class 1A, member 2 (MAN1A2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAN1A2 (Myc-DDK tagged) - Human mannosidase, alpha, class 1A, member 2 (MAN1A2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human mannosidase, alpha, class 1A, member 2 (MAN1A2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAN1A2 (mGFP-tagged) - Human mannosidase, alpha, class 1A, member 2 (MAN1A2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MAN1A2 (GFP-tagged) - Human mannosidase, alpha, class 1A, member 2 (MAN1A2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human mannosidase, alpha, class 1A, member 2 (MAN1A2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human mannosidase, alpha, class 1A, member 2 (MAN1A2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
MAN1A2 (untagged)-Human mannosidase, alpha, class 1A, member 2 (MAN1A2)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-MAN1A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAN1A2 antibody: synthetic peptide directed towards the middle region of human MAN1A2. Synthetic peptide located within the following region: FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE |
Transient overexpression of MAN1A2 (NM_006699) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAN1A2 (NM_006699) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAN1A2 (NM_006699) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack