Products

View as table Download

Lenti ORF particles, MAN1A2 (Myc-DDK tagged) - Human mannosidase, alpha, class 1A, member 2 (MAN1A2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, MAN1A2 (mGFP-tagged) - Human mannosidase, alpha, class 1A, member 2 (MAN1A2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

MAN1A2 (Myc-DDK-tagged)-Human mannosidase, alpha, class 1A, member 2 (MAN1A2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human mannosidase, alpha, class 1A, member 2 (MAN1A2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MAN1A2 (Myc-DDK tagged) - Human mannosidase, alpha, class 1A, member 2 (MAN1A2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human mannosidase, alpha, class 1A, member 2 (MAN1A2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MAN1A2 (mGFP-tagged) - Human mannosidase, alpha, class 1A, member 2 (MAN1A2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MAN1A2 (GFP-tagged) - Human mannosidase, alpha, class 1A, member 2 (MAN1A2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human mannosidase, alpha, class 1A, member 2 (MAN1A2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human mannosidase, alpha, class 1A, member 2 (MAN1A2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

MAN1A2 (untagged)-Human mannosidase, alpha, class 1A, member 2 (MAN1A2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-MAN1A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAN1A2 antibody: synthetic peptide directed towards the middle region of human MAN1A2. Synthetic peptide located within the following region: FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE

Transient overexpression of MAN1A2 (NM_006699) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of MAN1A2 (NM_006699) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of MAN1A2 (NM_006699) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack