Products

View as table Download

Recombinant protein of human malectin (MLEC)

Tag C-Myc/DDK
Expression Host HEK293T

MLEC (GFP-tagged) - Human malectin (MLEC)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MLEC (untagged)-Human malectin (MLEC)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit polyclonal antibody to Malectin (Malectin)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 106 and 292 of Malectin (Uniprot ID#Q14165)

MLEC HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

KIAA0152 / MLEC Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Immunogen KIAA0152 / MLEC antibody was raised against synthetic 15 amino acid peptide from N-terminus of human MLEC. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Elephant, Panda, Horse, Rabbit, Pig, Pufferfish (100%); Chicken, Xenopus (87%); Stickleback, Tick (80%).

KIAA0152 / MLEC Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen KIAA0152 / MLEC antibody was raised against synthetic 18 amino acid peptide from internal region of human MLEC. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus, Xenopus, Zebrafish (100%); Stickleback (94%).

KIAA0152 / MLEC Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Pig, Rabbit
Immunogen KIAA0152 / MLEC antibody was raised against synthetic 18 amino acid peptide from internal region of human MLEC. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Platypus (100%); Mouse, Rat, Turkey, Chicken (94%); Xenopus, Pufferfish, Zebrafish (89%); Stickleback (83%).

KIAA0152 / MLEC Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon
Immunogen KIAA0152 / MLEC antibody was raised against synthetic 14 amino acid peptide from internal region of human MLEC. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Elephant, Panda, Horse, Rabbit, Pig, Chicken, Xenopus (100%).

Rabbit Polyclonal Anti-KIAA0152 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIAA0152 antibody: synthetic peptide directed towards the C terminal of human KIAA0152. Synthetic peptide located within the following region: TVDDVPKLQPHPGLEKKEEEEEEEEYDEGSNLKKQTNKNRVQSGPRTPNP

Malectin (29-269, His-tag) human protein, 0.25 mg

Tag His-tag
Expression Host E. coli

Malectin (29-269, His-tag) human protein, 50 µg

Tag His-tag
Expression Host E. coli

MLEC MS Standard C13 and N15-labeled recombinant protein (NP_055545)

Tag C-Myc/DDK
Expression Host HEK293

Transient overexpression of MLEC (NM_014730) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of MLEC (NM_014730) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of MLEC (NM_014730) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack