MLEC (Myc-DDK-tagged)-Human malectin (MLEC)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MLEC (Myc-DDK-tagged)-Human malectin (MLEC)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human malectin (MLEC)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF clone of Human malectin (MLEC), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, MLEC (Myc-DDK tagged) - Human malectin (MLEC), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, MLEC (mGFP-tagged) - Human malectin (MLEC), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MLEC (GFP-tagged) - Human malectin (MLEC)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MLEC (untagged)-Human malectin (MLEC)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal antibody to Malectin (Malectin)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 106 and 292 of Malectin (Uniprot ID#Q14165) |
MLEC HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
KIAA0152 / MLEC Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
Immunogen | KIAA0152 / MLEC antibody was raised against synthetic 15 amino acid peptide from N-terminus of human MLEC. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Elephant, Panda, Horse, Rabbit, Pig, Pufferfish (100%); Chicken, Xenopus (87%); Stickleback, Tick (80%). |
KIAA0152 / MLEC Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Pig, Horse, Gibbon |
Conjugation | Unconjugated |
Immunogen | KIAA0152 / MLEC antibody was raised against synthetic 18 amino acid peptide from internal region of human MLEC. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus, Xenopus, Zebrafish (100%); Stickleback (94%). |
KIAA0152 / MLEC Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Pig, Rabbit |
Immunogen | KIAA0152 / MLEC antibody was raised against synthetic 18 amino acid peptide from internal region of human MLEC. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Platypus (100%); Mouse, Rat, Turkey, Chicken (94%); Xenopus, Pufferfish, Zebrafish (89%); Stickleback (83%). |
KIAA0152 / MLEC Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Chicken, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
Immunogen | KIAA0152 / MLEC antibody was raised against synthetic 14 amino acid peptide from internal region of human MLEC. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Elephant, Panda, Horse, Rabbit, Pig, Chicken, Xenopus (100%). |
Rabbit Polyclonal Anti-KIAA0152 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KIAA0152 antibody: synthetic peptide directed towards the C terminal of human KIAA0152. Synthetic peptide located within the following region: TVDDVPKLQPHPGLEKKEEEEEEEEYDEGSNLKKQTNKNRVQSGPRTPNP |
Malectin (29-269, His-tag) human protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
Malectin (29-269, His-tag) human protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
Transient overexpression lysate of malectin (MLEC)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
MLEC MS Standard C13 and N15-labeled recombinant protein (NP_055545)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of MLEC (NM_014730) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MLEC (NM_014730) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MLEC (NM_014730) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack