Germany
Japan
United Kingdom
China
MOGAT2 (Myc-DDK-tagged)-Human monoacylglycerol O-acyltransferase 2 (MOGAT2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, MOGAT2 (Myc-DDK tagged) - Human monoacylglycerol O-acyltransferase 2 (MOGAT2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, MOGAT2 (mGFP-tagged) - Human monoacylglycerol O-acyltransferase 2 (MOGAT2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
MOGAT2 (GFP-tagged) - Human monoacylglycerol O-acyltransferase 2 (MOGAT2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human monoacylglycerol O-acyltransferase 2 (MOGAT2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MOGAT2 (Myc-DDK tagged) - Human monoacylglycerol O-acyltransferase 2 (MOGAT2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human monoacylglycerol O-acyltransferase 2 (MOGAT2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MOGAT2 (mGFP-tagged) - Human monoacylglycerol O-acyltransferase 2 (MOGAT2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MOGAT2 (untagged)-Human monoacylglycerol O-acyltransferase 2 (MOGAT2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of monoacylglycerol O-acyltransferase 2 (MOGAT2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human monoacylglycerol O-acyltransferase 2 (MOGAT2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human monoacylglycerol O-acyltransferase 2 (MOGAT2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
MOGAT2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Anti-MOGAT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KESAAHILNRK, from the internal region of the protein sequence according to NP_079374.2. |
Rabbit Polyclonal Anti-MOGAT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MOGAT2 antibody: synthetic peptide directed towards the middle region of human MOGAT2. Synthetic peptide located within the following region: LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGEN |
Transient overexpression of MOGAT2 (NM_025098) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MOGAT2 (NM_025098) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MOGAT2 (NM_025098) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MOGAT2
Families
- Transmembrane