Products

cDNA Clones (7)
Proteins (5)
Antibodies (3)
Jump to Filters
View as table Download
Olfactory receptor 10X1 (OR10X1) (NM_001004477) Human Tagged ORF Clone Lentiviral Particle
RC218457L3V

USD 820.00

6 Weeks

Lenti ORF particles, OR10X1 (Myc-DDK tagged) - Human olfactory receptor, family 10, subfamily X, member 1 (OR10X1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Olfactory receptor 10X1 (OR10X1) (NM_001004477) Human Tagged ORF Clone Lentiviral Particle
RC218457L4V

USD 820.00

6 Weeks

Lenti ORF particles, OR10X1 (mGFP-tagged) - Human olfactory receptor, family 10, subfamily X, member 1 (OR10X1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Olfactory receptor 10X1 (OR10X1) Rabbit Polyclonal Antibody
TA316090

USD 345.00

In Stock

Rabbit polyclonal anti-OR10X1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10X1.
Olfactory receptor 10X1 (OR10X1) Rabbit Polyclonal Antibody
TA344311

USD 475.00

5 Days

Rabbit Polyclonal Anti-OR10X1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR10X1 antibody: synthetic peptide directed towards the middle region of human OR10X1. Synthetic peptide located within the following region: NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP
Olfactory receptor 10X1 (OR10X1) (NM_001004477) Human Over-expression Lysate
LY423780

USD 396.00

In Stock

Transient overexpression lysate of olfactory receptor, family 10, subfamily X, member 1 (OR10X1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Olfactory receptor 10X1 (OR10X1) (Center) Rabbit Polyclonal Antibody
AP53014PU-N

USD 450.00

2 Weeks

Olfactory receptor 10X1 (OR10X1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 88-118 amino acids from the Center region of Human Olfactory receptor 10X1
Olfactory receptor 10X1 (OR10X1) ICC Control Block
TB418457

USD 1,070.00

4 Weeks

Transient overexpression of OR10X1 (NM_001004477) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Olfactory receptor 10X1 (OR10X1) Cytosection
TS418457

USD 225.00

4 Weeks

Transient overexpression of OR10X1 (NM_001004477) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Olfactory receptor 10X1 (OR10X1) Cytosection
TS418457P5

USD 889.00

4 Weeks

Transient overexpression of OR10X1 (NM_001004477) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack