Products

cDNA Clones (11)
Antibodies (3)
Proteins (3)
Jump to Filters
View as table Download
Parathyroid Hormone Receptor 2 (PTH2R) (NM_005048) Human Tagged ORF Clone Lentiviral Particle
RC207775L3V

USD 820.00

6 Weeks

Lenti ORF particles, PTH2R (Myc-DDK tagged) - Human parathyroid hormone 2 receptor (PTH2R), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Parathyroid Hormone Receptor 2 (PTH2R) (NM_005048) Human Tagged ORF Clone Lentiviral Particle
RC207775L4V

USD 820.00

6 Weeks

Lenti ORF particles, PTH2R (mGFP-tagged) - Human parathyroid hormone 2 receptor (PTH2R), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Parathyroid Hormone Receptor 2 (PTH2R) (NM_005048) Human Untagged Clone
SC127960

USD 760.00

In Stock

PTH2R (untagged)-Human parathyroid hormone 2 receptor (PTH2R)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SC127960 is the updated version of SC116961.
Parathyroid Hormone Receptor 2 (PTH2R) Rabbit Polyclonal Antibody
TA338168

USD 375.00

5 Days

Rabbit Polyclonal Anti-PTH2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTH2R antibody is: synthetic peptide directed towards the C-terminal region of Human PTH2R. Synthetic peptide located within the following region: NSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETED
Parathyroid Hormone Receptor 2 (PTH2R) Rabbit Polyclonal Antibody
TA317209

USD 425.00

5 Days

PTHR2 / PTH2R Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen PTHR2 / PTH2R antibody was raised against synthetic 20 amino acid peptide from 1st extracellular domain of human PTH2R / PTHR2. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (95%).
Parathyroid Hormone Receptor 2 (PTH2R) Rabbit Polyclonal Antibody
TA317210

USD 425.00

5 Days

PTHR2 / PTH2R Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen PTHR2 / PTH2R antibody was raised against synthetic 17 amino acid peptide from C-terminus of human PTH2R / PTHR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (94%); Marmoset (88%); Bovine, Panda (82%).
Parathyroid Hormone Receptor 2 (PTH2R) (NM_005048) ICC Control Block
TB407775

USD 1,070.00

4 Weeks

Transient overexpression of PTH2R (NM_005048) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Parathyroid Hormone Receptor 2 (PTH2R) Cytosection
TS407775

USD 225.00

4 Weeks

Transient overexpression of PTH2R (NM_005048) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Parathyroid Hormone Receptor 2 (PTH2R) Cytosection
TS407775P5

USD 889.00

4 Weeks

Transient overexpression of PTH2R (NM_005048) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack