Rabbit polyclonal ATDC Ac-K116 antibody
| Applications | WB |
| Reactivities | Bovine, Chimpanzee, Human, Macaque, Horse |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116. |
Rabbit Polyclonal Anti-SIAH3 Antibody
| Applications | WB |
| Reactivities | Human, Rabbit, Dog, Horse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIAH3 antibody is: synthetic peptide directed towards the N-terminal region of Human SIAH3. Synthetic peptide located within the following region: YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA |
Germany
Japan
United Kingdom
China