Products

View as table Download

Rabbit polyclonal antibody to ABCD2 (ATP-binding cassette, sub-family D (ALD), member 2)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 338 and 588 of ABCD2 (Uniprot ID#Q9UBJ2)

Rabbit Polyclonal Anti-ABCD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCD2 Antibody: synthetic peptide directed towards the N terminal of human ABCD2. Synthetic peptide located within the following region: FIIKLIKWLMIAIPATFVNSAIRYLECKLALAFRTRLVDHAYETYFTNQT

Rabbit Polyclonal Anti-ABCD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCD2 Antibody: synthetic peptide directed towards the middle region of human ABCD2. Synthetic peptide located within the following region: WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT

Anti-ABCD2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 274-288 amino acids of human ATP-binding cassette, sub-family D (ALD), member 2