Products

View as table Download

Rabbit Polyclonal Anti-LCAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LCAT antibody: synthetic peptide directed towards the C terminal of human LCAT. Synthetic peptide located within the following region: GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL

Rabbit polyclonal LCAT Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This LCAT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 285-313 amino acids from the Central region of human LCAT.

Rabbit Polyclonal Anti-LCAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LCAT antibody: synthetic peptide directed towards the N terminal of human LCAT. Synthetic peptide located within the following region: MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVI