Products

View as table Download

Rabbit polyclonal anti-OR13G1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR13G1.

Rabbit Polyclonal Anti-OR13G1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR13G1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR13G1. Synthetic peptide located within the following region: STCSSHLTVVTLYYSPVIYTYIRPASSYTFERDKVVAALYTLVTPTLNPM