Products

View as table Download

Rabbit polyclonal anti-PSMD3 antibody

Applications IHC, WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PSMD3.

Rabbit Polyclonal Proteasome 19S S3 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the N-Terminus Region

Rabbit polyclonal Anti-PSMD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMD3 antibody: synthetic peptide directed towards the N terminal of human PSMD3. Synthetic peptide located within the following region: RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAS

Rabbit polyclonal Anti-PSMD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMD3 antibody: synthetic peptide directed towards the middle region of human PSMD3. Synthetic peptide located within the following region: YSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQ

Anti-PSMD3 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3

Anti-PSMD3 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3

Anti-PSMD3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3