Products

View as table Download

Rabbit polyclonal anti-DMGDH antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human DMGDH.

Rabbit Polyclonal Anti-Dmgdh Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dmgdh antibody is: synthetic peptide directed towards the middle region of Mouse Dmgdh. Synthetic peptide located within the following region: SELHDLRWIEEAAFRGGYDVEIQNITDEFGVLGVAGPYARRVLQKLTSE