Products

View as table Download

Rabbit Polyclonal Anti-DUSP13 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DUSP13

Rabbit Polyclonal Anti-DUSP13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DUSP13 antibody is: synthetic peptide directed towards the N-terminal region of Human DUSP13. Synthetic peptide located within the following region: DRRLKASSTNCPSEKCTAWARYSHRMDSLQKQDLRRPKIHGAVQASPYQP

DUSP13 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DUSP13