Products

View as table Download

Rabbit polyclonal anti-GHRHR antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GHRHR.

Rabbit Polyclonal Anti-GHRHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the N terminal of human GHRHR. Synthetic peptide located within the following region: VTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEE

Rabbit Polyclonal Anti-GHRHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the middle region of human GHRHR. Synthetic peptide located within the following region: PYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRR

Rabbit Polyclonal Anti-GHRHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the C terminal of human GHRHR. Synthetic peptide located within the following region: YWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWYCVFV

GHRHR rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GHRHR

GHRHR Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human GHRHR (NP_000814.2).
Modifications Unmodified